Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.19
PubTator Score 5.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 3.7e-03
atypical teratoid / rhabdoid tumor -1.300 1.3e-05
ependymoma -1.300 4.5e-07
glioblastoma -1.100 7.3e-06
group 3 medulloblastoma -1.100 1.1e-02
interstitial lung disease 1.100 8.0e-03
medulloblastoma, large-cell -1.700 7.1e-04
osteosarcoma -2.405 1.2e-03
ovarian cancer -1.200 1.7e-05
subependymal giant cell astrocytoma -1.505 2.8e-02

Gene RIF (6)

AA Sequence

MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG      1 - 70
LHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD                          71 - 119
//

Text Mined References (12)

PMID Year Title