Property Summary

NCBI Gene PubMed Count 10
Grant Count 2
Funding $405,000
PubMed Score 4.10
PubTator Score 5.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession P61236 Q65Z99 Q86VK6 Q9BSJ4 Q9CQB6
Symbols

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
21671470 YPEL3 expression, which is induced by the removal of estrogen or treatment with tamoxifen triggers cellular senescence in MCF-7 cells while loss of YPEL3 increases the growth rate of MCF-7 cells.
21267786 YPEL3 is downregulated in colon tumors.
21196260 In this review we show that transcriptionally active forms of p73 and p63, family members of p53, can transactivate the human YPEL3 gene[review]
20508983 Observational study of gene-disease association. (HuGE Navigator)
20388804 Findings point to YPEL3 being a novel tumor suppressor, which upon induction triggers a permanent growth arrest in human tumor and normal cells.

AA Sequence

MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG      1 - 70
LHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD                          71 - 119
//

Text Mined References (11)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
21671470 2012 Novel senescence associated gene, YPEL3, is repressed by estrogen in ER+ mammary tumor cells and required for tamoxifen-induced cellular senescence.
21267786 2011 Senescence-associated gene YPEL3 is downregulated in human colon tumors.
21196260 2011 Why YPEL3 represents a novel tumor suppressor.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20388804 2010 YPEL3, a p53-regulated gene that induces cellular senescence.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15556292 2004 Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...