Property Summary

NCBI Gene PubMed Count 44
PubMed Score 41.06
PubTator Score 24.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 1.100 3.1e-17
hepatocellular carcinoma 1.100 1.1e-03
invasive ductal carcinoma 1.300 7.5e-03
limb girdle muscular dystrophy 2A -1.010 1.8e-03
non-small cell lung cancer 1.024 2.0e-15
osteosarcoma 1.182 2.8e-05
ovarian cancer 2.500 2.2e-05
pancreatic cancer 1.300 1.0e-02
primary pancreatic ductal adenocarcinoma 1.087 2.3e-02
psoriasis 1.100 3.8e-42
tuberculosis and treatment for 3 months -1.400 7.2e-03

Gene RIF (15)

AA Sequence

MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER      1 - 70
FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI     71 - 140
AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC              141 - 200
//

Text Mined References (51)

PMID Year Title