Property Summary

NCBI Gene PubMed Count 41
Grant Count 41
R01 Count 38
Funding $2,700,094.62
PubMed Score 33.34
PubTator Score 24.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (15)

PMID Text
26289115 The Anaplasma phagocytophilum surface protein, uridine monophosphate kinase, was identified as a guanine nucleotide-independent, Rab10-specific ligand.
26082458 the target gene RAB10 regulated by miRNA-369-3p, miRNA-30e-5p, miRNA-30e-3p, and miRNA-655 may play key role in the progression and development of AD.
25103239 Rab10 is a target of the GTPase-activating protein AS160, which is inhibited after phosphorylation by the protein kinase Akt.
24509846 Rab10 silencing increased the plasma membrane residence of HAS3, resulting in a significant increase of hyaluronan secretion and an enlarged cell surface HA coat, whereas Rab10 overexpression suppressed hyaluronan synthesis.
23263280 Rab10 regulates endoplasmic reticulum dynamics/morphology. Suggest that these dynamics could be coupled to phospholipid synthesis.
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related protein Rab-10 (RAB10), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related protein Rab-10 (RAB10), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related protein Rab-10 (RAB10), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related protein Rab-10 (RAB10), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21454697 Insulin-stimulated GLUT4 protein translocation in adipocytes requires the Rab10 guanine nucleotide exchange factor Dennd4C
More...

AA Sequence

MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER      1 - 70
FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI     71 - 140
AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC              141 - 200
//

Text Mined References (47)

PMID Year Title
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
26289115 2016 Anaplasma phagocytophilum Rab10-dependent parasitism of the trans-Golgi network is critical for completion of the infection cycle.
26082458 2016 Identification of Biomarkers Associated With Alzheimer's Disease by Bioinformatics Analysis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25103239 2014 A Rab10:RalA G protein cascade regulates insulin-stimulated glucose uptake in adipocytes.
24891604 2014 Rab18 and a Rab18 GEF complex are required for normal ER structure.
24509846 2014 Rab10-mediated endocytosis of the hyaluronan synthase HAS3 regulates hyaluronan synthesis and cell adhesion to collagen.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
More...