Property Summary

NCBI Gene PubMed Count 41
PubMed Score 33.34
PubTator Score 24.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.80017199304591E-42
Breast cancer 3099 3.051128904638E-17
non-small cell lung cancer 2798 2.03938881441521E-15
ovarian cancer 8492 2.21929566616996E-5
osteosarcoma 7933 2.84840877131314E-5
tuberculosis and treatment for 6 months 686 3.45739207246456E-4
hepatocellular carcinoma 550 0.00110870688575862
limb girdle muscular dystrophy 2A 156 0.00179874864019078
invasive ductal carcinoma 2950 0.00750082710782053
pancreatic cancer 2300 0.0101237011765994
primary pancreatic ductal adenocarcinoma 1271 0.0233862000863332

Expression

  Differential Expression (11)

Synonym

Accession P61026 D6W538 O88386 Q6IA52 Q9D7X6 Q9H0T3
Symbols

Gene

PDB

5LPN   5SZJ  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (12)

PMID Text
26289115 The Anaplasma phagocytophilum surface protein, uridine monophosphate kinase, was identified as a guanine nucleotide-independent, Rab10-specific ligand.
26082458 the target gene RAB10 regulated by miRNA-369-3p, miRNA-30e-5p, miRNA-30e-3p, and miRNA-655 may play key role in the progression and development of AD.
25103239 Rab10 is a target of the GTPase-activating protein AS160, which is inhibited after phosphorylation by the protein kinase Akt.
24509846 Rab10 silencing increased the plasma membrane residence of HAS3, resulting in a significant increase of hyaluronan secretion and an enlarged cell surface HA coat, whereas Rab10 overexpression suppressed hyaluronan synthesis.
23263280 Rab10 regulates endoplasmic reticulum dynamics/morphology. Suggest that these dynamics could be coupled to phospholipid synthesis.
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related protein Rab-10 (RAB10), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21454697 Insulin-stimulated GLUT4 protein translocation in adipocytes requires the Rab10 guanine nucleotide exchange factor Dennd4C
21070595 Rab10 and Rab8A are new cytoplasmic factors implicated in WPB biogenesis that play a role in generating granules that can rapidly respond to secretagogue
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20028485 Rab10, acting upstream of Rab5, plays a prominent role in phagolysosome formation and can modulate Mycobacterium-containing phagosomes maturation
More...

AA Sequence

MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER      1 - 70
FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI     71 - 140
AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC              141 - 200
//

Text Mined References (47)

PMID Year Title
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
26289115 2016 Anaplasma phagocytophilum Rab10-dependent parasitism of the trans-Golgi network is critical for completion of the infection cycle.
26082458 2016 Identification of Biomarkers Associated With Alzheimer's Disease by Bioinformatics Analysis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25103239 2014 A Rab10:RalA G protein cascade regulates insulin-stimulated glucose uptake in adipocytes.
24891604 2014 Rab18 and a Rab18 GEF complex are required for normal ER structure.
24509846 2014 Rab10-mediated endocytosis of the hyaluronan synthase HAS3 regulates hyaluronan synthesis and cell adhesion to collagen.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
More...