Property Summary

NCBI Gene PubMed Count 60
PubMed Score 188.27
PubTator Score 96.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.523 1.8
HIV Infections 100

Expression

Synonym

Accession P60842 B2R6L8 D3DTP9 J3QLC4 P04765 Q5U018 Q61516 eIF-4A-I
Symbols DDX2A
EIF4A
EIF-4A
eIF4A-I
eIF-4A-I

Gene

PDB

2ZU6   2G9N   3EIQ  

Gene RIF (32)

PMID Text
26614665 Studies indicate a developing focus on targeting eukaryotic initiation factor 4A eIF4A1 and eIF4A2 as cancer therapy.
26113725 eIF4A functions as an adenosine triphosphate-dependent processive helicase when complexed with two accessory proteins, eIF4G and eIF4B.
25866185 Collectively, these data suggested that a potential role of NS4A in antagonizing host antiviral defense is by recruiting eIF4AI and escaping the translation inhibition mediated by PKR.
25779044 demonstrate that DAP5 associates with eIF2beta and eIF4AI to stimulate IRES-dependent translation of cellular mRNAs
25611378 Immunohistochemical analysis was performed on over 3000 breast tumors to investigate the relationship among expression of eIF4A1, the helicase-modulating proteins eIF4B, eIF4E and PDCD4, and clinical outcome.
25320244 Data indicate that caspase recruitment domain family, member 11 protein CARD11 has complex 5'UTRs and is sensitive to eIF4A RNA helicase inhibition.
25079319 report of an eIF4A RNA helicase-dependent mechanism of translational control that contributes to oncogenesis and underlies the anticancer effects of silvestrol and related compounds
24909782 Studies indicate that eukaryotic initiation factor 4AI (EIF4AI) undergoes large conformational transitions, while unwinding RNA hairpins.
24844222 Increased Expression of EIF4A1 is associated with poor response to Brachytherapy in Cervical Cancer.
24471916 The E186 residue was found to be of significance for RNA-dependent ATPase activity for eIF4AI alone and in the presence of eIF4AI-binding domains of eIF4GI, binding between eIF4AI and eIF4GI domains were also significantly influenced by mutation of E186.
More...

AA Sequence

MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGY      1 - 70
DVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNV     71 - 140
RAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVV    141 - 210
LLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFIN    211 - 280
TRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLP    281 - 350
TNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI                  351 - 406
//

Text Mined References (74)

PMID Year Title
26614665 2015 Translational dysregulation in cancer: eIF4A isoforms and sequence determinants of eIF4A dependence.
26113725 2015 RNA BIOCHEMISTRY. Factor-dependent processivity in human eIF4A DEAD-box helicase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25866185 2015 Eukaryotic initiation factor 4AI interacts with NS4A of Dengue virus and plays an antiviral role.
25779044 2015 DAP5 associates with eIF2? and eIF4AI to promote Internal Ribosome Entry Site driven translation.
25611378 2015 The malignant phenotype in breast cancer is driven by eIF4A1-mediated changes in the translational landscape.
25320244 2014 Inhibiting CARD11 translation during BCR activation by targeting the eIF4A RNA helicase.
25079319 2014 RNA G-quadruplexes cause eIF4A-dependent oncogene translation in cancer.
24909782 2014 Single-molecule kinetics of the eukaryotic initiation factor 4AI upon RNA unwinding.
24844222 2014 Decreased expression of EIF4A1 after preoperative brachytherapy predicts better tumor-specific survival in cervical cancer.
More...