Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.56
PubTator Score 2.63

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24014093 direct interaction of human CTRP8 with RXFP1
19666007 two novel human C1q/TNF family members, designated as CTRP8 and CTRP9B were described.

AA Sequence

MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVRPTIDIEILKG      1 - 70
EKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFSVGRREGLHSSDHFQAVPFDT     71 - 140
ELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSVMQAQSLMLL    141 - 210
LAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSGHLVKPAAEL                                211 - 252
//

Text Mined References (4)

PMID Year Title
24014093 2013 C1q-tumour necrosis factor-related protein 8 (CTRP8) is a novel interaction partner of relaxin receptor RXFP1 in human brain cancer cells.
19666007 2009 CTRP8 and CTRP9B are novel proteins that hetero-oligomerize with C1q/TNF family members.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.