Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.56
PubTator Score 2.63

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVRPTIDIEILKG      1 - 70
EKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFSVGRREGLHSSDHFQAVPFDT     71 - 140
ELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSVMQAQSLMLL    141 - 210
LAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSGHLVKPAAEL                                211 - 252
//

Text Mined References (4)

PMID Year Title