Property Summary

NCBI Gene PubMed Count 24
Grant Count 3
R01 Count 3
Funding $117,331.99
PubMed Score 19.27
PubTator Score 41.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.300 0.001
psoriasis -1.100 0.000

Gene RIF (10)

PMID Text
25781974 These results thereby demonstrate that induced expression of Syncytin-2 is highly dependent on the interaction of bZIP-containing transcription factors to a CRE/AP-1 motif and that this element is important for the regulation of Syncytin-2 expression
23177091 MFSD2a, the Syncytin-2 receptor, is important for trophoblast fusion.
21771862 Analysis of non-spliced ERVFRDE1 mRNAs and env mRNAs detected efficient splicing of endogenously expressed RNAs in trophoblastic but not in non-placental cells.
21493955 results further highlighted the existence of a correlation between the extent of the decrease in the expression levels of both syncytins 1 and 2 fusogenic proteins and the degree of severity of preeclampsia symptoms
19616006 These results highlight the importance of Syncytin-2 in BeWo and primary human trophoblast cell fusion.
18650494 expression decreased in preeclamptic placentas; may function as a second fusogenic protein for placental cell fusion
18215254 Syncytin 2 expression illustrates the abnormal trophoblast differentiation observed in placenta of fetal T21-affected pregnancies.
18077339 findings show that in both humans and mice, one of the two syncytins (human syncytin-2 and mouse syncytin-B) is immunosuppressive and, rather unexpectedly, the other (human syncytin-1 and mouse syncytin-A) is not
16714059 immunolocalized only in the villous trophoblast of the chorionic villi, at the level of cytotrophoblastic cells
16140326 The crystal structure of a central fragment of syncytin 2 "fossil" ectodomain is reported, allowing a remarkable superposition with the structures of the corresponding domains of present-day infectious retroviruses

AA Sequence

MGLLLLVLILTPSLAAYRHPDFPLLEKAQQLLQSTGSPYSTNCWLCTSSSTETPGTAYPASPREWTSIEA      1 - 70
ELHISYRWDPNLKGLMRPANSLLSTVKQDFPDIRQKPPIFGPIFTNINLMGIAPICVMAKRKNGTNVGTL     71 - 140
PSTVCNVTFTVDSNQQTYQTYTHNQFRHQPRFPKPPNITFPQGTLLDKSSRFCQGRPSSCSTRNFWFRPA    141 - 210
DYNQCLQISNLSSTAEWVLLDQTRNSLFWENKTKGANQSQTPCVQVLAGMTIATSYLGISAVSEFFGTSL    211 - 280
TPLFHFHISTCLKTQGAFYICGQSIHQCLPSNWTGTCTIGYVTPDIFIAPGNLSLPIPIYGNSPLPRVRR    281 - 350
AIHFIPLLAGLGILAGTGTGIAGITKASLTYSQLSKEIANNIDTMAKALTTMQEQIDSLAAVVLQNRRGL    351 - 420
DMLTAAQGGICLALDEKCCFWVNQSGKVQDNIRQLLNQASSLRERATQGWLNWEGTWKWFSWVLPLTGPL    421 - 490
VSLLLLLLFGPCLLNLITQFVSSRLQAIKLQTNLSAGRHPRNIQESPF                          491 - 538
//

Text Mined References (25)

PMID Year Title
27486264 2016 The role of syncytins in human reproduction and reproductive organ cancers.
25781974 2015 A CRE/AP-1-like motif is essential for induced syncytin-2 expression and fusion in human trophoblast-like model.
23492904 2013 A novel human endogenous retroviral protein inhibits cell-cell fusion.
23177091 2013 MFSD2a, the Syncytin-2 receptor, is important for trophoblast fusion.
21771862 2011 Epigenetic regulation of transcription and splicing of syncytins, fusogenic glycoproteins of retroviral origin.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
21493955 2011 Reduced expression of both syncytin 1 and syncytin 2 correlates with severity of preeclampsia.
19616006 2009 Syncytin-2 plays an important role in the fusion of human trophoblast cells.
18988732 2008 A placenta-specific receptor for the fusogenic, endogenous retrovirus-derived, human syncytin-2.
18650494 2008 Functional characterization of the human placental fusogenic membrane protein syncytin 2.
More...