Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.05
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Synonym

Accession P60369 A3KN67 Q70LJ4
Symbols KAP10.3
KAP18-3
KAP18.3
KRTAP10.3
KRTAP18-3
KRTAP18.3

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MATSTMSVCSSAYSDSWQVDACPESCCEPPCCATSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSPCQSG      1 - 70
CTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCKPVCCKPICCVPVCSGASSSCCQQS     71 - 140
SRQPACCTTSCCRPSSSVSLLCRPVCRSTCCVPIPSCCAPASTCQPSCCRPASCVSLLCRPTCSRLSSAC    141 - 210
CGLSSGQKSSC                                                               211 - 221
//

Text Mined References (6)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028290 2004 A cluster of 21 keratin-associated protein genes within introns of another gene on human chromosome 21q22.3.
14962103 2004 Hair keratin associated proteins: characterization of a second high sulfur KAP gene domain on human chromosome 21.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359730 2002 Characterization of a first domain of human high glycine-tyrosine and high sulfur keratin-associated protein (KAP) genes on chromosome 21q22.1.
10830953 2000 The DNA sequence of human chromosome 21.