Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.05
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.6e-05
diabetes mellitus 1728 3.0e-03

AA Sequence

MATSTMSVCSSAYSDSWQVDACPESCCEPPCCATSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSPCQSG      1 - 70
CTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCKPVCCKPICCVPVCSGASSSCCQQS     71 - 140
SRQPACCTTSCCRPSSSVSLLCRPVCRSTCCVPIPSCCAPASTCQPSCCRPASCVSLLCRPTCSRLSSAC    141 - 210
CGLSSGQKSSC                                                               211 - 221
//

Text Mined References (6)

PMID Year Title