Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.3e-03
psoriasis 6694 3.0e-02

AA Sequence

MCHTSHSSGCPMACPGSPCCVPSTCYPPEGYGTSCCCSAPCVALLCRPLCGVSTCCQPACCVPSPCQVAC      1 - 70
CVPVSCKPVLCVASFCPTSGCCQPFCPTLVYRPVTWSTPTGC                                 71 - 112
//

Text Mined References (6)

PMID Year Title