Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-03
psoriasis 6694 3.4e-03

AA Sequence

MCHTSCSPACQPTCCIHSPCQASCYVPVSCQSSVCMPVSCTRIVCVAPSCQPSVCVPVSCRPIIYVTPSC      1 - 70
QSSGCCQPPCTTALCRPISCSTPSCC                                                 71 - 96
//

Text Mined References (3)

PMID Year Title