Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Synonym

Accession P60328
Symbols KRTAP12.3

Gene

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MCHTSCSPACQPTCCIHSPCQASCYVPVSCQSSVCMPVSCTRIVCVAPSCQPSVCVPVSCRPIIYVTPSC      1 - 70
QSSGCCQPPCTTALCRPISCSTPSCC                                                 71 - 96
//

Text Mined References (3)

PMID Year Title
15028290 2004 A cluster of 21 keratin-associated protein genes within introns of another gene on human chromosome 21q22.3.
14962103 2004 Hair keratin associated proteins: characterization of a second high sulfur KAP gene domain on human chromosome 21.
10830953 2000 The DNA sequence of human chromosome 21.