Property Summary

NCBI Gene PubMed Count 10
PubMed Score 37.26
PubTator Score 8.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Infertility, Male 46 0.0 0.0
Disease Target Count
Male infertility 206
Disease Target Count Z-score Confidence
Spermatocytoma 2 4.135 2.1
Infertility 188 3.464 1.7

Expression

Gene RIF (3)

AA Sequence

MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNG      1 - 70
ESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR       71 - 138
//

Text Mined References (11)

PMID Year Title