Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
Funding $2,020,144.25
PubMed Score 32.10
PubTator Score 8.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P60321 Q17R30 Q4G0P8 NOS-2
Symbols NOS2
ZC2HC12B

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
19168545 Data describe for the first time the expression pattern of the NANOS2 gene in human tissues and show that it is testis specific. We found that NANOS2 protein is present in prenatal germ cells and at later stages in spermatogenesis.
14615895 The increased NO production with increased expression of iNOS and ncNOS may contribute to the pathological and physiological features of UVB-induced erythema and skin inflammation.

AA Sequence

MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNG      1 - 70
ESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR       71 - 138
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24736845 2014 Structural basis for the Nanos-mediated recruitment of the CCR4-NOT complex and translational repression.
22899867 2012 Analysis of meiosis regulators in human gonads: a sexually dimorphic spatio-temporal expression pattern suggests involvement of DMRT1 in meiotic entry.
21421998 2011 NANOS3 function in human germ cell development.
19168545 2009 The highly conserved NANOS2 protein: testis-specific expression and significance for the human male reproduction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14615895 2003 Expression of nitric oxide synthases in keratinocytes after UVB irradiation.
12947200 2003 Conserved role of nanos proteins in germ cell development.
12690449 2003 Conservation of a Pumilio-Nanos complex from Drosophila germ plasm to human germ cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.