Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.96
PubTator Score 5.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 1.7

Gene RIF (1)

AA Sequence

MMRTLITTHPLPLLLLPQQLLQLVQFQEVDTDFDFPEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVL      1 - 70
IEPGMPLNHIEYCNHEIMGKNVYYKHRWVAEHYFLLMQYDELQKICYNRFVPCKNGIRKCNRSKGLVEGV     71 - 140
YCNLTEAFEIPACKYESLYRKGYVLITCSWQNEMQKRIPHTINDLVEPPEHRSFLSEDGVFVISP         141 - 205
//

Text Mined References (11)

PMID Year Title