Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.96
PubTator Score 5.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
15974301 may be involved in host defense

AA Sequence

MMRTLITTHPLPLLLLPQQLLQLVQFQEVDTDFDFPEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVL      1 - 70
IEPGMPLNHIEYCNHEIMGKNVYYKHRWVAEHYFLLMQYDELQKICYNRFVPCKNGIRKCNRSKGLVEGV     71 - 140
YCNLTEAFEIPACKYESLYRKGYVLITCSWQNEMQKRIPHTINDLVEPPEHRSFLSEDGVFVISP         141 - 205
//

Text Mined References (11)

PMID Year Title
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
19137000 2009 Human ribonuclease 9, a member of ribonuclease A superfamily, specifically expressed in epididymis, is a novel sperm-binding protein.
18992174 2008 Cloning, expression and location of RNase9 in human epididymis.
15974301 2004 LOC 390443 (RNase 9) on chromosome 14q11.2 is related to the RNase A superfamily and contains a unique amino-terminal preproteinlike sequence.
15676279 2005 The ribonuclease A superfamily of mammals and birds: identifying new members and tracing evolutionary histories.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12920233 2003 Discovery in silico and characterization in vitro of novel genes exclusively expressed in the mouse epididymis.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
More...