Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
pilocytic astrocytoma 3,086

Expression

Gene RIF (1)

PMID Text
17852044 We found significantly lower levels of HILS1, TNP1, and TNP2 transcripts in spermatozoa from asthenozoospermic men compared to normozoospermic men.

AA Sequence

MLHASTIWHLRSTPPRRKQWGHCDPHRILVASEVTTEITSPTPAPRAQVCGGQPWVTVLDPLSGHTGREA      1 - 70
ERHFATVSISAVELKYCHGWRPAGQRVPSKTATGQRTCAKPCQKPSTSKVILRAVADKGTCKYVSLATLK     71 - 140
KAVSTTGYDMARNAYHFKRVLKGLVDKGSAGSFTLGKKQASKSKLKVKRQRQQRWRSGQRPFGQHRSLLG    141 - 210
SKQGHKRLIKGVRRVAKCHCN                                                     211 - 231
//

Text Mined References (8)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
26257145 2015 Mapping of post-translational modifications of spermatid-specific linker histone H1-like protein, HILS1.
23357345 2013 Rapid evolution of the mammalian HILS1 gene and the nuclear condensation process during mammalian spermiogenesis.
19896661 2010 Histone gene expression profile during spermatogenesis.
17852044 Quantitative assessment of transition proteins 1, 2 spermatid-specific linker histone H1-like protein transcripts in spermatozoa from normozoospermic and asthenozoospermic men.
14636221 2003 Isolation and characterization of a novel cDNA encoding a DNA-binding protein (Hils1) specifically expressed in testicular haploid germ cells.
12920187 2003 HILS1 is a spermatid-specific linker histone H1-like protein implicated in chromatin remodeling during mammalian spermiogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.