Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Pilocytic astrocytoma 56 8.5e-04

Expression

Gene RIF (1)

AA Sequence

MLHASTIWHLRSTPPRRKQWGHCDPHRILVASEVTTEITSPTPAPRAQVCGGQPWVTVLDPLSGHTGREA      1 - 70
ERHFATVSISAVELKYCHGWRPAGQRVPSKTATGQRTCAKPCQKPSTSKVILRAVADKGTCKYVSLATLK     71 - 140
KAVSTTGYDMARNAYHFKRVLKGLVDKGSAGSFTLGKKQASKSKLKVKRQRQQRWRSGQRPFGQHRSLLG    141 - 210
SKQGHKRLIKGVRRVAKCHCN                                                     211 - 231
//

Text Mined References (8)

PMID Year Title