Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.8e-05

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 1.8e-05

AA Sequence

MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDV      1 - 70
YSDWIDACEAANQ                                                              71 - 83
//

Text Mined References (7)

PMID Year Title