Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.28
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
psoriasis 6,685
ulcerative colitis 2,087 1.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.200 0.000

Gene RIF (2)

PMID Text
26034043 Longevity-associated variant-BPIFB4 may represent a novel therapeutic tool to fight endothelial dysfunction and promote vascular reparative processes.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWMAWCVAALSVVAVCGTSHETNTVLRVTKDVLSNAISGMLQQSDALHSALREVPLGVGDIPYNDFHVRG      1 - 70
PPPVYTNGKKLDGIYQYGHIETNDNTAQLGGKYRYGEILESEGSIRDLRNSGYRSAENAYGGHRGLGRYR     71 - 140
AAPVGRLHRRELQPGEIPPGVATGAVGPGGLLGTGGMLAADGILAGQGGLLGGGGLLGDGGLLGGGGVLG    141 - 210
VLGEGGILSTVQGITGLRIVELTLPRVSVRLLPGVGVYLSLYTRVAINGKSLIGFLDIAVEVNITAKVRL    211 - 280
TMDRTGYPRLVIERCDTLLGGIKVKLLRGLLPNLVDNLVNRVLADVLPDLLCPIVDVVLGLVNDQLGLVD    281 - 350
SLIPLGILGSVQYTFSSLPLVTGEFLELDLNTLVGEAGGGLIDYPLGWPAVSPKPMPELPPMGDNTKSQL    351 - 420
AMSANFLGSVLTLLQKQHALDLDITNGMFEELPPLTTATLGALIPKVFQQYPESCPLIIRIQVLNPPSVM    421 - 490
LQKDKALVKVLATAEVMVSQPKDLETTICLIDVDTEFLASFSTEGDKLMIDAKLEKTSLNLRTSNVGNFD    491 - 560
IGLMEVLVEKIFDLAFMPAMNAVLGSGVPLPKILNIDFSNADIDVLEDLLVLSA                    561 - 614
//

Text Mined References (8)

PMID Year Title
26034043 2015 Genetic Analysis Reveals a Longevity-Associated Protein Modulating Endothelial Function and Angiogenesis.
21787333 2011 Systematic nomenclature for the PLUNC/PSP/BSP30/SMGB proteins as a subfamily of the BPI fold-containing superfamily.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
14739326 2004 Phylogenetic and evolutionary analysis of the PLUNC gene family.
12887310 2003 Comparative analysis of the PLUNC (palate, lung and nasal epithelium clone) protein families.
12837268 2003 Expansion of the BPI family by duplication on human chromosome 20: characterization of the RY gene cluster in 20q11.21 encoding olfactory transporters/antimicrobial-like peptides.
11971875 2002 PLUNC: a novel family of candidate host defence proteins expressed in the upper airways and nasopharynx.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.