Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.09
PubTator Score 2.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.2e-03
Disease Target Count Z-score Confidence
Staphyloenterotoxemia 18 5.679 2.8
Hereditary spherocytosis type 4 18 3.59 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 2.2e-03

AA Sequence

MNNQARTPAPSSARTSTSVRASTPTRTPTPLRTPTPVRTRTPIRTLTPVLTPSPAGTSPLVLTPAPAQIP      1 - 70
TLVPTPALARIPRLVPPPAPAWIPTPVPTPVPVRNPTPVPTPARTLTPPVRVPAPAPAQLLAGIRAALPV     71 - 140
LDSYLAPALPLDPPPEPAPELPLLPEEDPEPAPSLKLIPSVSSEAGPAPGPLPTRTPLAANSPGPTLDFT    141 - 210
FRADPSAIGLADPPIPSPVPSPILGTIPSAISLQNCTETFPSSSENFALDKRVLIRVTYCGLUSYSLRYI    211 - 280
LLKKSLEQQFPNHLLFEEDRAAQATGEFEVFVNGRLVHSKKRGDGFVNESRLQKIVSVIDEEIKKR        281 - 346
//

Text Mined References (6)

PMID Year Title