Property Summary

NCBI Gene PubMed Count 29
Grant Count 258
R01 Count 182
Funding $32,086,209.44
PubMed Score 35.07
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
West Nile fever 6 3.656 1.8
Mite infestation 2 3.065 1.5

Expression

Synonym

Accession P59665 P11479 Q14125 Q6EZF6
Symbols HP1
HP-1
HNP-1

Gene

PDB

2KHT   2PM1   3GNY   3H6C   3HJ2   3HJD   3LO1   3LO2   3LO4   3LO6   3LO9   3LOE   3LVX   4DU0   4LB1   4LB7   4LBB   4LBF  

Gene RIF (3)

PMID Text
25517613 binding of HNP1 to affected bacterial toxins caused their local unfolding, potentiated their thermal melting and precipitation, exposed new regions for proteolysis, and increased susceptibility to collisional quenchers.
19169650 Data show that H. pylori induces alpha-defensin release from granulocytes, which may be important in local host response to H. pylori infection in gastroduodenal diseases.
2997278 DEFA1B encodes an antibacterial peptide that is bacteriocidal against S. aureus, E. coli, and P. aeruginosa.

AA Sequence

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRI      1 - 70
PACIAGERRYGTCIYQGRLWAFCC                                                   71 - 94
//

Text Mined References (31)

PMID Year Title
25517613 2014 Human defensins facilitate local unfolding of thermodynamically unstable regions of bacterial protein toxins.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21904558 2011 Structural and Functional Consequences Induced by Post-Translational Modifications in ?-Defensins.
21861873 2011 Alpha-defensins 1-3 release by dendritic cells is reduced by estrogen.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19169650 2009 Helicobacter pylori induces the release of alpha-defensin by human granulocytes.
18083107 2007 Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.
17452329 2007 Toward understanding the cationicity of defensins. Arg and Lys versus their noncoded analogs.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
More...