Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P59090 Q3MIX8
Symbols C21orf90

 Compartment GO Term (0)

AA Sequence

MGNPRLPRLLCALKFSGFLSNIRGPLAGEDGMGDTQLARVRDSALKTPWRPAPCPPPAHSLDDWK           1 - 65
//

Text Mined References (5)

PMID Year Title