Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P59090 Q3MIX8
Symbols C21orf90

Gene

 Compartment GO Term (0)

AA Sequence

MGNPRLPRLLCALKFSGFLSNIRGPLAGEDGMGDTQLARVRDSALKTPWRPAPCPPPAHSLDDWK           1 - 65
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036297 2002 Nineteen additional unpredicted transcripts from human chromosome 21.
10830953 2000 The DNA sequence of human chromosome 21.