Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.5e-05
Disease Target Count Z-score Confidence
Down syndrome 499 3.285 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.307 4.5e-05

Synonym

Accession P59022 Q52LN2
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MQIVQGFPADAPLCALMWTCSFLLPGLQTETPYPCTSLCLSSSQSAHPPLPVRVFSAESGYGIPFCAEPC      1 - 70
SRVTVCHLQAVPVCMPV                                                          71 - 87
//

Text Mined References (4)

PMID Year Title