Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Down syndrome 548 3.283 1.6
osteosarcoma 7,933

Expression

Synonym

Accession P59022 Q52LN2
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20485444 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQIVQGFPADAPLCALMWTCSFLLPGLQTETPYPCTSLCLSSSQSAHPPLPVRVFSAESGYGIPFCAEPC      1 - 70
SRVTVCHLQAVPVCMPV                                                          71 - 87
//

Text Mined References (4)

PMID Year Title
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168953 2002 Identification of two novel primate-specific genes in DSCR.