Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Down syndrome 499 3.605 1.8

Synonym

Accession P59020 B2R8P8
Symbols NCRNA00038

Gene

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MGRICPVNSRARRLRARPGRPSGDSLPYHQLQGGAPRLWSPDPGRPAAYRRAHVCDVTAPRWGSTSRQGE      1 - 70
GAVLQRMLGRRAPPSWSRDHAYSRRGWENAALFLNRKRKQEGTENTSICCRPESALACGGNLSPQFLKKV     71 - 140
IQIQTQELW                                                                 141 - 149
//

Text Mined References (7)

PMID Year Title