Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession P59020 B2R8P8
Symbols NCRNA00038

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20463881 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRICPVNSRARRLRARPGRPSGDSLPYHQLQGGAPRLWSPDPGRPAAYRRAHVCDVTAPRWGSTSRQGE      1 - 70
GAVLQRMLGRRAPPSWSRDHAYSRRGWENAALFLNRKRKQEGTENTSICCRPESALACGGNLSPQFLKKV     71 - 140
IQIQTQELW                                                                 141 - 149
//

Text Mined References (7)

PMID Year Title
20463881 2010 Digital quantification of human eye color highlights genetic association of three new loci.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168953 2002 Identification of two novel primate-specific genes in DSCR.
10830953 2000 The DNA sequence of human chromosome 21.