Property Summary

NCBI Gene PubMed Count 44
Grant Count 215
R01 Count 142
Funding $59,520,522.82
PubMed Score 1204.09
PubTator Score 49.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 2.000 0.000
psoriasis -2.200 0.000

Synonym

Accession P58743 Q496J2 Q7Z7F3 Q86UF8 Q86UF9 Q86UG0
Symbols PRES
DFNB61

Gene

PANTHER Protein Class (1)

Gene RIF (28)

PMID Text
26283790 anion-pi interaction is the mechanism for the voltage-dependent response of prestin
25920562 I hypothesize that serum assays of OHC specific protein, prestin, will allow detection and quantification of OHC damage before audiometric testing can identify presence of hearing loss.
24453323 Calmodulin-prestin interaction may be involved in the medial olivocochlear-mediated modulation of cochlear amplification
24138858 The effects of fast temperature jumps induced by an infrared (IR) laser in control and prestin (SLC26a5)-transfected human embryonic kidney (HEK) cells, are reproted.
23660400 COCH and SLC26A5 mRNA are expressed in specific structures and cells of the inner ear in archival human temporal bone
23542924 The findings suggest that CASK and the truncated prestin splice isoform contribute to confinement of prestin to the basolateral region of the plasma membrane.
23212912 prestin subunits are individually functional within a given multimer
21975444 This result implies that in cell membranes prestin oligomerizes to a tetramer.
21813750 Four mutations (C124A, C192A, C260A, and C415A), all in nonconserved cysteinyl residues, significantly differed in their nonlinear capacitance properties compared with wild-type prestin.
20668687 Observational study of genetic testing. (HuGE Navigator)
More...

AA Sequence

MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKW      1 - 70
LPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVI     71 - 140
SLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLV    141 - 210
RGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNE    211 - 280
RFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVG    281 - 350
FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM    351 - 420
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLIT    421 - 490
AVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKT    491 - 560
GVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQ    561 - 630
RFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWE    631 - 700
LLFHSIHDAVLGSQLREALAEQEASAPPSQEDLEPNATPATPEA                              701 - 744
//

Text Mined References (44)

PMID Year Title
26283790 2015 Glutamate transporter homolog-based model predicts that anion-? interaction is the mechanism for the voltage-dependent response of prestin.
25920562 2015 Prestin as a biochemical marker for early detection of acquired sensorineural hearing loss.
24647542 2014 N-glycosylation and topology of the human SLC26 family of anion transport membrane proteins.
24453323 2014 Functional regulation of the SLC26-family protein prestin by calcium/calmodulin.
24138858 2013 IR laser-induced perturbations of the voltage-dependent solute carrier protein SLC26a5.
23762468 2013 Real time measures of prestin charge and fluorescence during plasma membrane trafficking reveal sub-tetrameric activity.
23665419 Prenatal smoke exposure: effects on infant auditory system and placental gene expression.
23660400 2013 RNA analysis of inner ear cells from formalin fixed paraffin embedded (FFPE) archival human temporal bone section using laser microdissection--a technical report.
23542924 2013 Generation of somatic electromechanical force by outer hair cells may be influenced by prestin-CASK interaction at the basal junction with the Deiter's cell.
23506885 The SLC26 gene family of anion transporters and channels.
More...