Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.10
PubTator Score 8.08

Knowledge Summary

Patent (300)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.2

AA Sequence

MNWVNDSIIQEFILLGFSDRPWLEFPLLVVFLISYTVTIFGNLTIILVSRLDTKLHTPMYFFLTNLSLLD      1 - 70
LCYTTCTVPQMLVNLCSIRKVISYRGCVAQLFIFLALGATEYLLLAVMSFDRFVAICRPLHYSVIMHQRL     71 - 140
CLQLAAASWVTGFSNSVWLSTLTLQLPLCDPYVIDHFLCEVPALLKLSCVETTANEAELFLVSELFHLIP    141 - 210
LTLILISYAFIVRAVLRIQSAEGRQKAFGTCGSHLIVVSLFYSTAVSVYLQPPSPSSKDQGKMVSLFYGI    211 - 280
IAPMLNPLIYTLRNKEVKEGFKRLVARVFLIKK                                         281 - 313
//

Text Mined References (5)

PMID Year Title