Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.10
PubTator Score 8.08

Knowledge Summary

Patent (300)

TINX Plot

  Disease Sources (2)

Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 1.0
Disease Target Count Z-score Confidence
post-traumatic stress disorder 45 3.506 1.8

Expression

Synonym

Accession P58173 O43883 Q6IF89 Q9H5B0
Symbols OR2B1
OR2B5
OR2B1P
OR2B6P
OR5-40
OR5-41
OR6-31
dJ408B20.2

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid

AA Sequence

MNWVNDSIIQEFILLGFSDRPWLEFPLLVVFLISYTVTIFGNLTIILVSRLDTKLHTPMYFFLTNLSLLD      1 - 70
LCYTTCTVPQMLVNLCSIRKVISYRGCVAQLFIFLALGATEYLLLAVMSFDRFVAICRPLHYSVIMHQRL     71 - 140
CLQLAAASWVTGFSNSVWLSTLTLQLPLCDPYVIDHFLCEVPALLKLSCVETTANEAELFLVSELFHLIP    141 - 210
LTLILISYAFIVRAVLRIQSAEGRQKAFGTCGSHLIVVSLFYSTAVSVYLQPPSPSSKDQGKMVSLFYGI    211 - 280
IAPMLNPLIYTLRNKEVKEGFKRLVARVFLIKK                                         281 - 313
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9500546 1998 Distribution of olfactory receptor genes in the human genome.