Property Summary

NCBI Gene PubMed Count 7
Grant Count 1
Funding $31,902.33
PubMed Score 2.71
PubTator Score 2.46

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGDWNLLGDTLEEVHIHSTMIGKIWLTILFIFRMLVLGVAAEDVWNDEQSGFICNTEQPGCRNVCYDQAF      1 - 70
PISLIRYWVLQVIFVSSPSLVYMGHALYRLRVLEEERQRMKAQLRVELEEVEFEMPRDRRRLEQELCQLE     71 - 140
KRKLNKAPLRGTLLCTYVIHIFTRSVVEVGFMIGQYLLYGFHLEPLFKCHGHPCPNIIDCFVSRPTEKTI    141 - 210
FLLFMQSIATISLFLNILEIFHLGFKKIKRGLWGKYKLKKEHNEFHANKAKQNVAKYQSTSANSLKRLPS    211 - 280
APDYNLLVEKQTHTAVYPSLNSSSVFQPNPDNHSVNDEKCILDEQETVLSNEISTLSTSCSHFQHISSNN    281 - 350
NKDTHKIFGKELNGNQLMEKRETEGKDSKRNYYSRGHRSIPGVAIDGENNMRQSPQTVFSLPANCDWKPR    351 - 420
WLRATWGSSTEHENRGSPPKGNLKGQFRKGTVRTLPPSQGDSQSLDIPNTADSLGGLSFEPGLVRTCNNP    421 - 490
VCPPNHVVSLTNNLIGRRVPTDLQI                                                 491 - 515
//

Text Mined References (9)

PMID Year Title
20979653 2010 Expression of connexin genes in the human retina.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12881038 Expression profiles of the novel human connexin genes hCx30.2, hCx40.1, and hCx62 differ from their putative mouse orthologues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11941580 2002 [Molecular cloning of the human CX 58 gene].
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.