Property Summary

NCBI Gene PubMed Count 21
PubMed Score 30.54
PubTator Score 14.44

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 5.14332766076121E-12
pilocytic astrocytoma 3086 1.67335577124019E-8
glioblastoma 5572 9.49771644822162E-7
group 4 medulloblastoma 1875 9.46472394729723E-6
atypical teratoid/rhabdoid tumor 1095 2.82997506959132E-5
pediatric high grade glioma 2712 1.79822482664311E-4
diabetes mellitus 1663 0.00127775942739447
medulloblastoma, large-cell 6234 0.00226752564171152
astrocytic glioma 2241 0.00688288410250977
oligodendroglioma 2849 0.00807373185133448
facioscapulohumeral dystrophy 286 0.0104469949315072
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 2 19 3.099 1.5


  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.800 0.007
posterior fossa group B ependymoma -2.900 0.000
oligodendroglioma -1.800 0.008
glioblastoma -2.200 0.000
group 4 medulloblastoma -2.900 0.000
atypical teratoid/rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -2.000 0.002
diabetes mellitus 1.100 0.001
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -2.800 0.000
facioscapulohumeral dystrophy 2.300 0.010


Accession P57771 B4DGL9 Q3SYD2 RGS8


PANTHER Protein Class (2)


2ODE   2IHD   5DO9  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

 GO Function (1)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
1423 screening 750 / 0 / 217728 Multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao.
1836 screening 48 / 0 / 1610 Single point concentration, multiplexed high-throughput screen for confirmation of small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao.
1869 confirmatory 50 / 0 / 135 Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao.
2307 confirmatory 24 / 0 / 12 Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao for SAR Compounds
2827 confirmatory 0 / 0 / 5 Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao with additional round of SAR compounds

Gene RIF (5)

21135262 Missense mutations in RGS8 gene is associated with breast cancer.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18834863 Spinophilin was identified as an RGS8-interacting protein.
18262772 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

TCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS                                  141 - 180

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21135262 2011 High-resolution melting analysis for mutation screening of RGSL1, RGS16, and RGS8 in breast cancer.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18834863 2008 Spinophilin inhibits the binding of RGS8 to M1-mAChR but enhances the regulatory function of RGS8.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
18262772 2008 Association of RGS2 and RGS5 variants with schizophrenia symptom severity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15677457 2005 Regulators of G-protein signaling form a quaternary complex with the agonist, receptor, and G-protein. A novel explanation for the acceleration of signaling activation kinetics.