Property Summary

NCBI Gene PubMed Count 26
Grant Count 8
R01 Count 4
Funding $484,179.5
PubMed Score 33.63
PubTator Score 18.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26314219 Klf-3 expression is downregulated in human metastatic sarcomas, and Klf-3 levels negatively correlate with miR-182 expression.
25979369 Among the mechanosensitive genes, the two transcription factors, HoxA5 and Klf3, contain cAMP-response-elements methylation of which could serve as a mechanosensitive master switch in gene expression in atherosclerosis. (Review)
23918807 A feedback loop consisting of microRNA 23a/27a and the beta-like globin suppressors KLF3 and SP1 regulates globin gene expression.
22003205 B cell differentiation is significantly impaired in the bone marrow, spleen, and peritoneal cavity of Klf3 null mice; the defects are cell autonomous.
21470678 Low KLF3 is associated with acute myeloid leukemia.
21360637 KLF3 is an important regulator of several biological processes, including adipogenesis, erythropoiesis, and B cell development. (Review)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15937668 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDLTVNKRS      1 - 70
SPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLSMPPVMAAALSRHGIRSPG     71 - 140
ILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKIKIEPGIEPQRTDY    141 - 210
YPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAH    211 - 280
RRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV         281 - 345
//

Text Mined References (31)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26314219 2015 Epigenetic silencing of Kruppel like factor-3 increases expression of pro-metastatic miR-182.
25979369 2015 The role of epigenetics in the endothelial cell shear stress response and atherosclerosis.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23918807 2013 A feedback loop consisting of microRNA 23a/27a and the ?-like globin suppressors KLF3 and SP1 regulates globin gene expression.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23652523 2013 Identification of genetic loci associated with Helicobacter pylori serologic status.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...