Property Summary

NCBI Gene PubMed Count 26
PubMed Score 33.63
PubTator Score 18.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
ependymoma 1.300 4.4e-05
oligodendroglioma 1.400 6.1e-03
chronic lymphosyte leukemia -1.600 3.6e-03
glioblastoma 2.400 1.6e-04
medulloblastoma 1.900 2.5e-03
atypical teratoid / rhabdoid tumor 1.600 1.0e-03
medulloblastoma, large-cell 1.600 9.9e-06
juvenile dermatomyositis 1.065 1.4e-08
acute quadriplegic myopathy 1.344 2.8e-05
primary pancreatic ductal adenocarcinoma 1.210 4.0e-03
tuberculosis and treatment for 6 months 1.100 7.1e-05
intraductal papillary-mucinous neoplasm ... 1.400 1.1e-02
Breast cancer 2.200 3.5e-02
interstitial cystitis -1.400 9.7e-04
pediatric high grade glioma 1.700 8.3e-04
pilocytic astrocytoma 1.600 1.6e-03
lung adenocarcinoma -1.200 2.8e-10
spina bifida -1.608 2.8e-02
ovarian cancer -2.400 1.6e-07
pancreatic cancer 1.100 1.3e-02

Gene RIF (11)

PMID Text
26314219 Klf-3 expression is downregulated in human metastatic sarcomas, and Klf-3 levels negatively correlate with miR-182 expression.
25979369 Among the mechanosensitive genes, the two transcription factors, HoxA5 and Klf3, contain cAMP-response-elements methylation of which could serve as a mechanosensitive master switch in gene expression in atherosclerosis. (Review)
23918807 A feedback loop consisting of microRNA 23a/27a and the beta-like globin suppressors KLF3 and SP1 regulates globin gene expression.
22003205 B cell differentiation is significantly impaired in the bone marrow, spleen, and peritoneal cavity of Klf3 null mice; the defects are cell autonomous.
21470678 Low KLF3 is associated with acute myeloid leukemia.
21360637 KLF3 is an important regulator of several biological processes, including adipogenesis, erythropoiesis, and B cell development. (Review)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15937668 Observational study of gene-disease association. (HuGE Navigator)
15684403 The recruitment of CtBP and sumoylation are required for full repression by BKLF.

AA Sequence

MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDLTVNKRS      1 - 70
SPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLSMPPVMAAALSRHGIRSPG     71 - 140
ILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKIKIEPGIEPQRTDY    141 - 210
YPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAH    211 - 280
RRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV         281 - 345
//

Text Mined References (31)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26314219 2015 Epigenetic silencing of Kruppel like factor-3 increases expression of pro-metastatic miR-182.
25979369 2015 The role of epigenetics in the endothelial cell shear stress response and atherosclerosis.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23918807 2013 A feedback loop consisting of microRNA 23a/27a and the ?-like globin suppressors KLF3 and SP1 regulates globin gene expression.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23652523 2013 Identification of genetic loci associated with Helicobacter pylori serologic status.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22003205 2011 Impaired B cell development in the absence of Krüppel-like factor 3.
21470678 2011 Deregulated expression of Kruppel-like factors in acute myeloid leukemia.
21360637 2011 The mammalian zinc finger transcription factor Krüppel-like factor 3 (KLF3/BKLF).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18391014 2008 Targeted disruption of the basic Krüppel-like factor gene (Klf3) reveals a role in adipogenesis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15937668 2005 Single nucleotide polymorphisms in the gene encoding Krüppel-like factor 7 are associated with type 2 diabetes.
15684403 2005 Role for SUMO modification in facilitating transcriptional repression by BKLF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12812068 2003 [cDNA cloning, subcellular localization and tissue expression of a new human Krüppel-like transcription factor: human basic Krüppel-like factor (hBKLF)].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10582345 1999 Basic Krüppel-like factor functions within a network of interacting haematopoietic transcription factors.
9724649 1998 Cloning and characterization of mCtBP2, a co-repressor that associates with basic Krüppel-like factor and other mammalian transcriptional regulators.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7750094 1995 Identification of novel genes from stomach cancer cell lines by differential display.