Property Summary

NCBI Gene PubMed Count 27
Grant Count 30
R01 Count 24
Funding $2,082,417.5
PubMed Score 51.58
PubTator Score 37.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25649652 This study showed thatJAM2 (rs2829841; intronic), associated with Alzheimer disease.
24357068 Function of Jam-B/Jam-C interaction in homing and mobilization of human and mouse hematopoietic stem and progenitor cells.
23277282 These data brought new evidences for the role of JAM2 and JAM3 in progression of gastric adenocarcinoma
20624003 The expression of tight junction proteins ZO-1, JAM-2, Occludin, Claudin-3 and Claudin-5 is modulated by HIV-1 gp120, and the modulated TJ expression involves Rho-A activation
18574677 The expression of tight junction proteins ZO-1, JAM-2, Occludin, Claudin-3 and Claudin-5 is modulated by HIV-1 gp120, and the modulated TJ expression involves Rho-A activation
18329007 The expression of tight junction proteins ZO-1, JAM-2, Occludin, Claudin-3 and Claudin-5 is modulated by HIV-1 gp120, and the modulated TJ expression involves Rho-A activation
17822725 Examine JAM-2 expression in normal/inflammed lymphatic endothelium.
12476045 Results suggest a role for junctional adhesion molecule-2 (JAM-2) in facilitating transmigration in endothelial cells
12070135 interacts with alpha4beta1; Facilitation by JAM3
12070135 Discovery as ligand for the integrin alpha4beta1
More...

AA Sequence

MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSV      1 - 70
SFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCE     71 - 140
VPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTG    141 - 210
EYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSS    211 - 280
KATTMSENDFKHTKSFII                                                        281 - 298
//

Text Mined References (27)

PMID Year Title
25649652 2015 Linking Genetics of Brain Changes to Alzheimer's Disease: Sparse Whole Genome Association Scan of Regional MRI Volumes in the ADNI and AddNeuroMed Cohorts.
24357068 2014 Function of Jam-B/Jam-C interaction in homing and mobilization of human and mouse hematopoietic stem and progenitor cells.
23277282 2013 Junctional adhesion molecules 2 and 3 may potentially be involved in progression of gastric adenocarcinoma tumors.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
17822725 2008 Expression of junctional adhesion molecules on the human lymphatic endothelium.
17525755 2007 The role of junctional adhesion molecules in vascular inflammation.
16381901 2006 The LIFEdb database in 2006.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...