Property Summary

NCBI Gene PubMed Count 29
PubMed Score 50.60
PubTator Score 37.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute myeloid leukemia -1.300 3.7e-02
adrenocortical carcinoma -1.529 2.5e-02
astrocytic glioma 1.600 4.6e-02
Breast cancer -1.500 4.4e-11
breast carcinoma -1.200 1.1e-05
colon cancer -2.100 1.0e-02
cystic fibrosis 1.586 6.2e-05
Duchenne muscular dystrophy 1.002 2.5e-08
ductal carcinoma in situ -1.100 8.1e-03
glioblastoma 1.100 2.5e-05
group 3 medulloblastoma -1.100 1.9e-02
intraductal papillary-mucinous adenoma (... -1.700 1.6e-03
intraductal papillary-mucinous carcinoma... -2.100 4.9e-04
intraductal papillary-mucinous neoplasm ... -2.000 6.9e-03
invasive ductal carcinoma -1.463 1.4e-03
lung adenocarcinoma -1.900 2.1e-14
lung cancer -4.100 7.7e-06
lung carcinoma -1.900 9.4e-11
medulloblastoma, large-cell -2.400 8.5e-03
mucosa-associated lymphoid tissue lympho... -1.202 2.2e-02
nephrosclerosis 1.111 1.8e-03
non-small cell lung cancer -2.516 6.8e-28
oligodendroglioma 1.500 3.5e-02
ovarian cancer -1.200 9.2e-04
pediatric high grade glioma 1.300 5.3e-05
primary Sjogren syndrome 1.400 4.3e-04
ulcerative colitis 1.300 1.1e-04

Gene RIF (15)

AA Sequence

MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSV      1 - 70
SFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCE     71 - 140
VPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTG    141 - 210
EYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSS    211 - 280
KATTMSENDFKHTKSFII                                                        281 - 298
//

Text Mined References (29)

PMID Year Title