Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.20
PubTator Score 4.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.500 9.9e-05
Astrocytoma, Pilocytic 2.100 1.6e-06
autosomal dominant Emery-Dreifuss muscul... 1.360 2.2e-02
cystic fibrosis -1.694 3.2e-05
gastric cancer 1.700 9.0e-03
glioblastoma 1.300 1.9e-03
head and neck cancer -1.500 2.9e-02
hepatocellular carcinoma 1.600 5.0e-05
interstitial cystitis 1.200 5.5e-03
lung carcinoma 1.300 1.4e-30
malignant mesothelioma -1.600 1.0e-06
pancreatic cancer 2.200 3.2e-03
pancreatic carcinoma 2.200 3.2e-03
sarcoidosis 1.300 4.8e-02

Synonym

Accession P57077 D3DSE0 Q8TCL9
Symbols TAKL
TAK1L
TAKL-1
TAKL-2
TAKL-4
C21orf7
HC21ORF7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

 Compartment GO Term (1)

AA Sequence

MVQLIAPLEVMWNEAADLKPLALSRRLECSGGIMAHYSPDLLGPEMESRYFAQVGLEHLASSSPPAFGFL      1 - 70
KCLDYSISVLCSATSLAMLEDNPKVSKLATGDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELD     71 - 140
QQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEAL    141 - 210
TEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS                                          211 - 242
//

Text Mined References (16)

PMID Year Title