Property Summary

NCBI Gene PubMed Count 15
Grant Count 7
R01 Count 5
Funding $373,290.44
PubMed Score 2.83
PubTator Score 4.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.700 0.009
hepatocellular carcinoma 1.600 0.000
pancreatic cancer 2.200 0.003
malignant mesothelioma -1.600 0.000
glioblastoma 1.300 0.002
cystic fibrosis -1.694 0.000
autosomal dominant Emery-Dreifuss muscul... 1.360 0.022
sarcoidosis 1.300 0.048
interstitial cystitis 2.100 0.000
adult high grade glioma 1.500 0.000
pilocytic astrocytoma 2.100 0.000
pancreatic carcinoma 2.200 0.003
lung carcinoma 1.300 0.000
head and neck cancer -1.500 0.029

AA Sequence

MVQLIAPLEVMWNEAADLKPLALSRRLECSGGIMAHYSPDLLGPEMESRYFAQVGLEHLASSSPPAFGFL      1 - 70
KCLDYSISVLCSATSLAMLEDNPKVSKLATGDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELD     71 - 140
QQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEAL    141 - 210
TEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS                                          211 - 242
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15168726 2004 Cloning and characterization of a novel human TGF-beta activated kinase-like gene.
14759258 2004 An unappreciated role for RNA surveillance.
More...