Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.61
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pilocytic astrocytoma 3086 1.28623426068181E-6
medulloblastoma, large-cell 6234 1.84782024125022E-4
ductal carcinoma in situ 1745 6.79485777912684E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00168970927955261
invasive ductal carcinoma 2950 0.00256297938106269
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00412910218209017
active ulcerative colitis 477 0.015060225630505
Disease Target Count Z-score Confidence
Glycerol kinase deficiency 10 4.625 2.3
Glycogen storage disease 37 3.77 1.9

Expression

Synonym

Accession P57057 D3DSJ7 Q9HAQ1
Symbols G3PP

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Pathway (1)

Gene RIF (1)

PMID Text
21949678 Data show that SLC37A1 and SLC37A2 are endoplasmic reticulum associated, P(i)-linked antiporters, that can transport glucose-6-phosphate.

AA Sequence

MARLPAGIRFIISFSRDQWYRAFIFILTFLLYASFHLSRKPISIVKGELHKYCTAWDEADVRFSSQNRKS      1 - 70
GSAAPHQLPDNETDCGWAPFDKNNYQQLLGALDYSFLCAYAVGMYLSGIIGERLPIRYYLTFGMLASGAF     71 - 140
TALFGLGYFYNIHSFGFYVVTQVINGLVQTTGWPSVVTCLGNWFGKGRRGLIMGVWNSHTSVGNILGSLI    141 - 210
AGYWVSTCWGLSFVVPGAIVAAMGIVCFLFLIEHPNDVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKN    211 - 280
KPLDPEMQCLLLSDGKGSIHPNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCLLFAKLVSYTFLFWL    281 - 350
PLYITNVDHLDAKKAGELSTLFDVGGIFGGILAGVISDRLEKRASTCGLMLLLAAPTLYIFSTVSKMGLE    351 - 420
ATIAMLLLSGALVSGPYTLITTAVSADLGTHKSLKGNAHALSTVTAIIDGTGSVGAALGPLLAGLLSPSG    421 - 490
WSNVFYMLMFADACALLFLIRLIHKELSCPGSATGDQVPFKEQ                               491 - 533
//

Text Mined References (7)

PMID Year Title
21949678 2011 SLC37A1 and SLC37A2 are phosphate-linked, glucose-6-phosphate antiporters.
19946888 2010 Defining the membrane proteome of NK cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11112347 2000 Cloning and characterization of a putative human glycerol 3-phosphate permease gene (SLC37A1 or G3PP) on 21q22.3: mutation analysis in two candidate phenotypes, DFNB10 and a glycerol kinase deficiency.
10830953 2000 The DNA sequence of human chromosome 21.