Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.26
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.400 0.013
oligodendroglioma -1.200 0.000
osteosarcoma -1.183 0.042
posterior fossa group B ependymoma 2.400 0.000
glioblastoma -1.100 0.020
group 3 medulloblastoma -1.400 0.041
medulloblastoma, large-cell -2.500 0.000
non-small cell lung cancer -1.393 0.000
colon cancer 1.800 0.012
active Crohn's disease 1.399 0.017
active ulcerative colitis 1.211 0.025
interstitial cystitis -1.200 0.000
lung adenocarcinoma -1.300 0.000
adult high grade glioma -1.200 0.009
nasopharyngeal carcinoma -1.900 0.000
lung carcinoma 1.100 0.002
ovarian cancer 1.300 0.001

Synonym

Accession P56597 B2R5G7 NDK-H 5
Symbols NM23H5
RSPH23
NM23-H5

Gene

PANTHER Protein Class (3)

Gene RIF (2)

PMID Text
22564704 study characterized for the first time the human NME5 promoter which is controlled by Sp1 transcription factor in pancreatic cancer
14499630 found that Nm23-H5 and NDP kinases A and B are differently distributed in spermatids and mature spermatozoa and could therefore be involved at various levels of sperm differentiation and function

AA Sequence

MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNL      1 - 70
TAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIR     71 - 140
FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPIVEE    141 - 210
PY                                                                        211 - 212
//

Text Mined References (12)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
22564704 2012 Transactivation of the human NME5 gene by Sp1 in pancreatic cancer cells.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14499630 2003 Nm23/NDP kinases in human male germ cells: role in spermiogenesis and sperm motility?
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...