Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.75
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P56555 Q4VB31
Symbols DCRB
DSCRB

Gene

Gene RIF (1)

PMID Text
18086574 transcription of DSCR4 gene is regulated positively by binding of OLF-1-like transcription factor and negatively by binding of E47-like transcription factor

AA Sequence

MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSG      1 - 70
LASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST                           71 - 118
//

Text Mined References (8)

PMID Year Title
21268042 2011 Hypomethylated DSCR4 is a placenta-derived epigenetic marker for trisomy 21.
18086574 2008 Analysis of the promoter region of human placenta-specific DSCR4 gene.
16288839 2006 Transcription of two human genes from a bidirectional endogenous retrovirus promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.
9503011 1998 Transcriptional map of the 2.5-Mb CBR-ERG region of chromosome 21 involved in Down syndrome.
9455479 1997 A novel gene isolated from human placenta located in Down syndrome critical region on chromosome 21.