Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.86
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 9.3e-05
Disease Target Count Z-score Confidence
Down syndrome 499 4.488 2.2
Gestational choriocarcinoma 5 3.313 1.7

Gene RIF (1)

AA Sequence

MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSG      1 - 70
LASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST                           71 - 118
//

Text Mined References (9)

PMID Year Title