Property Summary

NCBI Gene PubMed Count 40
PubMed Score 157.41
PubTator Score 79.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 1.4e-03
breast carcinoma 1.200 3.3e-18
COPD -1.300 5.8e-03
glioblastoma 1.200 2.7e-03
group 4 medulloblastoma 1.900 2.3e-04
lung cancer 1.100 5.6e-03
malignant mesothelioma 1.100 3.4e-05
medulloblastoma, large-cell 2.100 8.2e-06
osteosarcoma -1.765 1.2e-06
Polycystic ovary syndrome -1.040 4.1e-03
psoriasis -3.200 4.2e-06
Rheumatoid arthritis -1.400 2.3e-02

Gene RIF (26)

AA Sequence

MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPP      1 - 70
PTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAASTVDTAALKQPPAPPPPPPPV     71 - 140
SAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA    141 - 210
IHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHA    211 - 280
CEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPD    281 - 350
HLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV    351 - 420
CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW                 421 - 477
//

Text Mined References (45)

PMID Year Title