Tbio | Myc-associated zinc finger protein |
May function as a transcription factor with dual roles in transcription initiation and termination. Binds to two sites, ME1a1 and ME1a2, within the MYC promoter having greater affinity for the former. Also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors. Regulates inflammation-induced expression of serum amyloid A proteins.
Comments
Disease | Target Count |
---|---|
HIV Infections | 100 |
Disease | Target Count | P-value |
---|---|---|
breast carcinoma | 1614 | 3.3178907520615E-18 |
osteosarcoma | 7933 | 1.15419387211528E-6 |
psoriasis | 6685 | 4.22499937874725E-6 |
medulloblastoma, large-cell | 6234 | 8.20175229826502E-6 |
malignant mesothelioma | 3163 | 3.41427302878075E-5 |
lung cancer | 4473 | 1.53027667744426E-4 |
group 4 medulloblastoma | 1875 | 2.26171119290511E-4 |
atypical teratoid / rhabdoid tumor | 4369 | 0.00138524850752117 |
glioblastoma | 5572 | 0.0027494179833933 |
Polycystic Ovary Syndrome | 335 | 0.00414976986836825 |
COPD | 116 | 0.00575634956144638 |
Rheumatoid Arthritis | 1171 | 0.0230365114756902 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Amyloidosis | 68 | 3.008 | 1.5 |
Disease | log2 FC | p |
---|---|---|
Rheumatoid Arthritis | -1.400 | 0.023 |
malignant mesothelioma | 1.100 | 0.000 |
psoriasis | -3.200 | 0.000 |
osteosarcoma | -1.765 | 0.000 |
group 4 medulloblastoma | 1.900 | 0.000 |
atypical teratoid / rhabdoid tumor | 1.400 | 0.001 |
glioblastoma | 1.200 | 0.003 |
medulloblastoma, large-cell | 2.100 | 0.000 |
lung cancer | 1.800 | 0.000 |
COPD | -1.300 | 0.006 |
Polycystic Ovary Syndrome | -1.040 | 0.004 |
breast carcinoma | 1.200 | 0.000 |
Species | Source |
---|---|
Macaque | EggNOG Inparanoid |
Mouse | EggNOG Inparanoid |
Dog | EggNOG Inparanoid |
Anole lizard | EggNOG Inparanoid |
Xenopus | EggNOG Inparanoid |
PMID | Text |
---|---|
26902421 | Akt phosphorylates MAZ at Thr385, and the phosphorylated MAZ is released from the p53 promoter, leading to transcriptional activation of p53. |
25487955 | Myc-associated zinc-finger protein (MAZ) was identified as a direct target of miR-449a, mediating the tumor-suppressive effects. |
25449683 | Studies show a feed-forward regulatory pathway in breast cancer cells where SAF-1 acts as a transcriptional inducer of Ras which in turn increases DNA-binding and transcriptional activities of SAF-1 which in turn, increases transcription of Ras. |
25201524 | In conclusion, our present study indicated that miR-34c regulated the permeability of BTB via MAZ-mediated expression changes of ZO-1, occludin, and claudin-5. |
23609189 | Role of MAZ in prostate cancer and its interaction with androgen receptor were investigated. siRNA knockdown of AR significantly decreased MAZ expression, and knockdown of MAZ significantly increased the expression of AR. |
21665940 | these findings reveal that SAF-1 is a hitherto unrecognized participant in inducing VEGF expression in triple-negative breast cancer cells, an aggressive form of breast cancer that currently lacks effective treatment options. |
19583771 | Existence of multiple promoters regulation MAZ, which is expressed during inflammation. |
19242545 | Observational study of gene-disease association. (HuGE Navigator) |
19074642 | Gastrin activates paracrine networks leading to induction of PAI-2 via MAZ and ASC-1. |
19028685 | The SAF-1.c-Fos.c-Jun ternary complex efficiently promotes transcription from both SAF-1 and AP-1 sites of human MMP-1 promoter. |
More... |
MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPP 1 - 70 PTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAASTVDTAALKQPPAPPPPPPPV 71 - 140 SAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA 141 - 210 IHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHA 211 - 280 CEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPD 281 - 350 HLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV 351 - 420 CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW 421 - 477 //
PMID | Year | Title |
---|---|---|
26902421 | 2016 | Akt phosphorylates myc-associated zinc finger protein (MAZ), releases P-MAZ from the p53 promoter, and activates p53 transcription. |
25487955 | 2015 | MiR-449a exerts tumor-suppressive functions in human glioblastoma by targeting Myc-associated zinc-finger protein. |
25449683 | 2015 | Induction of Ras by SAF-1/MAZ through a feed-forward loop promotes angiogenesis in breast cancer. |
25201524 | 2015 | miR-34c regulates the permeability of blood-tumor barrier via MAZ-mediated expression changes of ZO-1, occludin, and claudin-5. |
23609189 | 2013 | The prostate cancer-up-regulated Myc-associated zinc-finger protein (MAZ) modulates proliferation and metastasis through reciprocal regulation of androgen receptor. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22681889 | 2012 | The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts. |
22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. |
21665940 | 2011 | Control of VEGF expression in triple-negative breast carcinoma cells by suppression of SAF-1 transcription factor activity. |
21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. |
More... |