Property Summary

NCBI Gene PubMed Count 35
Grant Count 24
R01 Count 16
Funding $2,258,403.95
PubMed Score 150.07
PubTator Score 79.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.023
malignant mesothelioma 1.100 0.000
psoriasis -3.200 0.000
osteosarcoma -1.765 0.000
group 4 medulloblastoma 1.900 0.000
atypical teratoid / rhabdoid tumor 1.400 0.001
glioblastoma 1.200 0.003
medulloblastoma, large-cell 2.100 0.000
lung cancer 1.800 0.000
COPD -1.300 0.006
Polycystic Ovary Syndrome -1.040 0.004
breast carcinoma 1.200 0.000

Gene RIF (21)

PMID Text
26902421 Akt phosphorylates MAZ at Thr385, and the phosphorylated MAZ is released from the p53 promoter, leading to transcriptional activation of p53.
25487955 Myc-associated zinc-finger protein (MAZ) was identified as a direct target of miR-449a, mediating the tumor-suppressive effects.
25449683 Studies show a feed-forward regulatory pathway in breast cancer cells where SAF-1 acts as a transcriptional inducer of Ras which in turn increases DNA-binding and transcriptional activities of SAF-1 which in turn, increases transcription of Ras.
25201524 In conclusion, our present study indicated that miR-34c regulated the permeability of BTB via MAZ-mediated expression changes of ZO-1, occludin, and claudin-5.
23609189 Role of MAZ in prostate cancer and its interaction with androgen receptor were investigated. siRNA knockdown of AR significantly decreased MAZ expression, and knockdown of MAZ significantly increased the expression of AR.
21665940 these findings reveal that SAF-1 is a hitherto unrecognized participant in inducing VEGF expression in triple-negative breast cancer cells, an aggressive form of breast cancer that currently lacks effective treatment options.
19583771 Existence of multiple promoters regulation MAZ, which is expressed during inflammation.
19242545 Observational study of gene-disease association. (HuGE Navigator)
19074642 Gastrin activates paracrine networks leading to induction of PAI-2 via MAZ and ASC-1.
19028685 The SAF-1.c-Fos.c-Jun ternary complex efficiently promotes transcription from both SAF-1 and AP-1 sites of human MMP-1 promoter.
More...

AA Sequence

MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPP      1 - 70
PTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAASTVDTAALKQPPAPPPPPPPV     71 - 140
SAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA    141 - 210
IHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHA    211 - 280
CEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPD    281 - 350
HLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV    351 - 420
CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW                 421 - 477
//

Text Mined References (40)

PMID Year Title
26902421 2016 Akt phosphorylates myc-associated zinc finger protein (MAZ), releases P-MAZ from the p53 promoter, and activates p53 transcription.
25487955 2015 MiR-449a exerts tumor-suppressive functions in human glioblastoma by targeting Myc-associated zinc-finger protein.
25449683 2015 Induction of Ras by SAF-1/MAZ through a feed-forward loop promotes angiogenesis in breast cancer.
25201524 2015 miR-34c regulates the permeability of blood-tumor barrier via MAZ-mediated expression changes of ZO-1, occludin, and claudin-5.
23609189 2013 The prostate cancer-up-regulated Myc-associated zinc-finger protein (MAZ) modulates proliferation and metastasis through reciprocal regulation of androgen receptor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21665940 2011 Control of VEGF expression in triple-negative breast carcinoma cells by suppression of SAF-1 transcription factor activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...