Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.69
PubTator Score 19.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.900 0.005
osteosarcoma -3.716 0.000
tuberculosis 1.100 0.000
non-small cell lung cancer -1.320 0.000
lung carcinoma -1.400 0.000
acute myeloid leukemia 1.600 0.026

Synonym

Accession P56202 Q86VT4
Symbols LYPN

Gene

Gene RIF (6)

PMID Text
26060270 These results establish CtsW as an important host factor for entry of influenza A virus into target cells and suggest that CtsW could be a promising target for the development of future antiviral drugs.
22050231 The predominant expression of wildtype form by infiltrating immune cells was confirmed in 116 patients with gastroesophageal reflux disease and 27 reflux-negative individuals demonstrating that cathepsin W expression is not altered in this disease.
19100676 Despite being expressed in the effector subset of CD8(+) and NK cells and of being released during target cell killing, our functional inhibition studies exclude an essential role of CatW in the process of cytotoxicity.
15358123 a genetic variant and a novel isoform of cathepsin W are present in about 14% and 12%, respectively, within the Caucasian population
12437118 Cathepsin W-positive cells had a 'lymphocyte phenotype', but the relative portion of cathepsin W-positive cells among the infiltrating leukocytes in gastrointestinal disease differed remarkably.
11490002 Endogenous cathepsin W is expressed predominantly in NK cells, is up-regulated by IL-2, and is mainly targeted to the endoplasmic reticulum.

AA Sequence

MALTAHPSCLLALLVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNL      1 - 70
AQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVASA     71 - 140
ISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLA    141 - 210
SEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKAT    211 - 280
PTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSN    281 - 350
TCGITKFPLTARVQKPDMKPRVSCPP                                                351 - 376
//

Text Mined References (19)

PMID Year Title
26060270 2015 Cathepsin W Is Required for Escape of Influenza A Virus from Late Endosomes.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22050231 2011 Expression pattern of cathepsin W isoforms in peripheral blood and gastroesophageal mucosa of patients with gastroesophageal reflux disease.
19946888 2010 Defining the membrane proteome of NK cells.
19100676 2009 Cathepsin W expressed exclusively in CD8+ T cells and NK cells, is secreted during target cell killing but is not essential for cytotoxicity in human CTLs.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358123 2004 Identification of a novel isoform predominantly expressed in gastric tissue and a triple-base pair polymorphism of the cathepsin W gene.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
More...