Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.92
PubTator Score 19.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 1.600 2.6e-02
cutaneous lupus erythematosus 1.900 5.0e-03
lung carcinoma -1.400 5.7e-10
non-small cell lung cancer -1.320 1.1e-17
osteosarcoma -3.716 7.1e-06
tuberculosis 1.100 3.5e-05

Gene RIF (7)

AA Sequence

MALTAHPSCLLALLVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNL      1 - 70
AQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVASA     71 - 140
ISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLA    141 - 210
SEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKAT    211 - 280
PTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSN    281 - 350
TCGITKFPLTARVQKPDMKPRVSCPP                                                351 - 376
//

Text Mined References (19)

PMID Year Title