Property Summary

NCBI Gene PubMed Count 205
PubMed Score 58.87
PubTator Score 1600.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.032 8.5e-03
atypical teratoid / rhabdoid tumor -1.700 3.9e-06
breast carcinoma 1.300 4.0e-03
chronic lymphosyte leukemia -1.100 5.9e-11
colon cancer 1.100 8.5e-03
esophageal adenocarcinoma 1.100 1.8e-02
gastric carcinoma 1.400 4.5e-02
group 3 medulloblastoma 1.200 1.6e-03
lung cancer 1.400 1.0e-03
malignant mesothelioma 1.300 1.3e-06
oligodendroglioma 1.400 3.0e-02
ovarian cancer 1.100 9.9e-04
pancreatic cancer 1.200 3.5e-05
psoriasis 1.600 3.7e-04
tuberculosis -1.100 4.0e-07

Protein-protein Interaction (2)

Gene RIF (157)

AA Sequence

MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLG      1 - 70
RIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPR     71 - 140
DMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD                   141 - 195
//

Text Mined References (211)

PMID Year Title