Property Summary

NCBI Gene PubMed Count 194
Grant Count 13
R01 Count 1
Funding $2,001,159.87
PubMed Score 52.97
PubTator Score 1600.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
oligodendroglioma 1.400 0.030
esophageal adenocarcinoma 1.100 0.018
psoriasis 1.600 0.000
chronic lymphosyte leukemia -1.100 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
tuberculosis -1.100 0.000
lung cancer 1.400 0.001
colon cancer 1.100 0.008
active Crohn's disease 1.032 0.008
pancreatic cancer 1.200 0.000
breast carcinoma 1.300 0.004
group 3 medulloblastoma 1.200 0.002
gastric carcinoma 1.400 0.045
ovarian cancer 1.600 0.000

 GO Function (1)

Gene RIF (150)

PMID Text
26827940 The BID-MTCH2 axis regulates the differentiation/apoptosis of stem cells and mitochondrial metabolism. (Review)
26699404 Data suggest, in models of spatial propagation of mitochondrial permeabilization during apoptosis, there appears to be requirement for cooperative signaling involving truncated-BID and ROS (reactive oxygen species) for efficient/ robust propagation.
26417093 Motifs of VDAC2 required for mitochondrial Bak import and tBid-induced apoptosis.
25522269 Tax confers apoptosis resistance to HTLV-1-infected T cells by suppressing the expression of Bim and Bid.
25404359 this study emphasizes that the coordinated action of hGzmB-activated p53 and GzmB-cleaved Bid is important for GzmB-induced cell death and for cytotoxic lymphocyte/Natural Killer Cell-mediated killing of target cells.
25368155 The extrinsic apoptotic pathway and BID are activated in adenomas from NSAID-treated patients. NSAIDS only activate BID in cells with APC deficiency and ensuing c-Myc activation.
25253693 Gli1 has a role in regulating the S-phase checkpoint in tumor cells via Bid protein, and its inhibition sensitizes to DNA topoisomerase 1 inhibitors
25208882 Inhibition of NANOGP8 or NANOG enhances the cytotoxicity of BH3 mimetics.
25077544 JNK1/2 regulate Bid by direct phosphorylation at Thr59.
24901048 Binding to membranes is regulated by cleavage of Bid to truncated Bid (tBid), by conformation changes in tBid and Bax, and by interactions with other proteins.
More...

AA Sequence

MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLG      1 - 70
RIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPR     71 - 140
DMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD                   141 - 195
//

Text Mined References (200)

PMID Year Title
26827940 2016 BCL-2 family proteins as regulators of mitochondria metabolism.
26699404 2016 An Analysis of the Truncated Bid- and ROS-dependent Spatial Propagation of Mitochondrial Permeabilization Waves during Apoptosis.
26417093 2015 Motifs of VDAC2 required for mitochondrial Bak import and tBid-induced apoptosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25522269 2014 Tax contributes apoptosis resistance to HTLV-1-infected T cells via suppression of Bid and Bim expression.
25416956 2014 A proteome-scale map of the human interactome network.
25404359 2015 Granzyme B-activated p53 interacts with Bcl-2 to promote cytotoxic lymphocyte-mediated apoptosis.
25368155 2014 BID mediates selective killing of APC-deficient cells in intestinal tumor suppression by nonsteroidal antiinflammatory drugs.
25253693 2014 Gli1 protein regulates the S-phase checkpoint in tumor cells via Bid protein, and its inhibition sensitizes to DNA topoisomerase 1 inhibitors.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...