Property Summary

NCBI Gene PubMed Count 164
Grant Count 109
R01 Count 66
Funding $9,898,231.8
PubMed Score 574.12
PubTator Score 293.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Duchenne muscular dystrophy -1.480 0.000
limb girdle muscular dystrophy 2A -1.044 0.005
Multiple Sclerosis -1.300 0.009
lung adenocarcinoma 1.600 0.000
dermatomyositis -1.600 0.020

Synonym

Accession P55916 O60475 Q96HL3 UCP 3
Symbols SLC25A9

Gene

Gene RIF (174)

PMID Text
26959981 UCP1 and UCP3 expression is associated with lipid and carbohydrate oxidation in patients submitted to bariatric surgery.
26310111 UCP3 overexpression limits keratinocyte proliferation and tumorigenesis through inhibition of Akt.
26304588 Combined, our data suggest functional significance of UCP-3 for H/R resistance
25826986 UCP3 genotype prevailed in the women of besieged Leningrad compared to relevant control groups of the persons of the same age who did not suffered hungry disaster.
25812254 BMI and TBF were significantly different among UCPI -3826A/G and UCP3 -55C/T genotype combinations, suggesting the existence of a gene interaction between UCP1 and UCP3 in influencing obesity and adiposity in multiethnic Malaysians.
25755013 A newly identified functional variant (rs1626521) in UCP-3 affects postprandial gastric functions and satiety and may contribute to weight gain and alter human mitochondrial function
25533680 Studied the impact of SNPs in/near UCP3 and RPTOR on obesity-related traits.
25081806 Children with UCP-3 -55 T/T genotype had a significantly lower adjusted metabolic rate than the C allele carriers.
24804925 The meta-analysis detected a significant association between the UCP2-866G/A, Ins/Del, Ala55Val and UCP3-55C/T polymorphisms and BMI mean differences.
24752406 Genotype and allele distributions of UCP1, UCP2 and UCP3 polymorphisms did not differ significantly between obese and non-obese Type 2 Diabetes Mellitus patients.[Meta-analysis]
More...

AA Sequence

MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVR      1 - 70
TEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVV     71 - 140
KVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDY    141 - 210
HLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSF    211 - 280
LRLGSWNVVMFVTYEQLKRALMKVQMLRESPF                                          281 - 312
//

Text Mined References (164)

PMID Year Title
26959981 2016 UCP1 and UCP3 Expression Is Associated with Lipid and Carbohydrate Oxidation and Body Composition.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26310111 2015 Mitochondrial uncoupling links lipid catabolism to Akt inhibition and resistance to tumorigenesis.
26304588 2015 UCP-3 uncoupling protein confers hypoxia resistance to renal epithelial cells and is upregulated in renal cell carcinoma.
25826986 2014 [Genotype and allele frequencies of UCP and PPAR gene families in residents of besieged Leningrad and in the control group].
25812254 2015 Association of UCP1 -3826A/G and UCP3 -55C/T gene polymorphisms with obesity and its related traits among multi-ethnic Malaysians.
25755013 2015 Association of UCP-3 rs1626521 with obesity and stomach functions in humans.
25533680 2014 Seasonal effects of the UCP3 and the RPTOR gene polymorphisms on obesity traits in Japanese adults.
25081806 Effects of energy expenditure gene polymorphisms on obesity-related traits in obese children.
24804925 2014 Meta-analysis reveals the association of common variants in the uncoupling protein (UCP) 1-3 genes with body mass index variability.
More...