Property Summary

NCBI Gene PubMed Count 168
PubMed Score 585.36
PubTator Score 293.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Obesity 678 5.757 2.9
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.367 2.2
Disease Target Count Z-score Confidence
Hyperglycemia 137 3.015 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis -1.600 2.0e-02
Duchenne muscular dystrophy -1.480 9.1e-05
limb girdle muscular dystrophy 2A -1.044 4.8e-03
lung adenocarcinoma 1.600 1.2e-05
Multiple Sclerosis -1.300 8.7e-03

Gene RIF (178)

AA Sequence

MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVR      1 - 70
TEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVV     71 - 140
KVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDY    141 - 210
HLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSF    211 - 280
LRLGSWNVVMFVTYEQLKRALMKVQMLRESPF                                          281 - 312
//

Text Mined References (168)

PMID Year Title