Property Summary

NCBI Gene PubMed Count 27
PubMed Score 33.48
PubTator Score 41.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.887 0.001
autosomal dominant Emery-Dreifuss muscul... 1.045 0.003
acute quadriplegic myopathy 1.204 0.000
Breast cancer 3.400 0.030
ovarian cancer 2.400 0.001
dermatomyositis 1.100 0.002

Synonym

Accession P55795 A1L400 Q9HHA7 hnRNP H2
Symbols FTP3
MRXSB
HNRPH'
HNRPH2
hnRNPH'

Gene

PDB

1WEZ   1WG5  

Gene RIF (11)

PMID Text
24690621 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein H2 (HNRNPH2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
24644279 Data indicate that armadillo repeat protein ARVCF interacts with the splicing factors the splicing factor SRSF1 (SF2/ASF), the RNA helicase p68 (DDX5), and the heterogeneous nuclear ribonucleoprotein hnRNP H2.
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein H2 (HNRNPH2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein H2 (HNRNPH2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein H2 (HNRNPH2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein H2 (HNRNPH2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein H2 (HNRNPH2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21068389 altered function of hnRNP H1/H2 in tumor cells is a novel determinant of aberrant thymidine phosphorylase splicing thereby resulting in acquired chemoresistance to TP-activated fluoropyrimidine anticancer drugs.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEEEVKLA      1 - 70
LKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNG     71 - 140
MTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPY    141 - 210
DRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGG    211 - 280
SSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKA    281 - 350
NMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY    351 - 420
GGGYGGQSSMSGYDQVLQENSSDYQSNLA                                             421 - 449
//

Text Mined References (38)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24644279 2014 Nuclear ARVCF protein binds splicing factors and contributes to the regulation of alternative splicing.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21068389 2011 Heterogeneous nuclear ribonucleoprotein H1/H2-dependent unsplicing of thymidine phosphorylase results in anticancer drug resistance.
More...