Property Summary

NCBI Gene PubMed Count 58
Grant Count 108
R01 Count 78
Funding $13,683,959.72
PubMed Score 164.33
PubTator Score 111.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P55287 A8K5D6 A8MZC8 B7WP28 Q15065 Q15066 Q9UQ93 Q9UQ94
Symbols OB
CAD11
CDHOB
OSF-4

Gene

PANTHER Protein Class (2)

Gene RIF (42)

PMID Text
26706910 Upregulation of miR-27b significantly accelerated the proliferation, cell cycle transition from G1 to S phase, migration and invasion of C33A cells, while downregulation of miR-27b suppressed the proliferation and invasion of HeLa cells
26519476 observations suggest that clathrin-mediated internalization of Cad11 regulates surface trafficking of Cad11 and that dynamic turnover of Cad11 regulates the migratory function of Cad11 in prostate cancer cells.
26476273 that U87-p75(NTR) cells express higher levels of Cdh-11 protein and that siRNA-mediated knockdown of Cdh-11 resulted in a significant decrease in p75(NTR)-mediated glioblastoma cell migration
26121083 Cadherin-11 may be hyper-expressed in the peripheral blood of diffuse systemic scleroderma patients.
26092671 High Cad-11 expression is associated with bone metastases of Ewing sarcoma.
26046821 Invasive cancer cells had increased expression of mesenchymal markers cadherin 2 and 11 that localized with stromal cell cadherin 11, suggesting that these molecules are involved in stromal cell engraftment.
25919928 Data suggest methylation status of gene promoters for CDH11 (cadherin 11) and BASP1 (brain abundant membrane attached signal protein 1) in tumor, skin, and metastatic tumor tissue may serve as prognostic biomarkers in patients with advanced melanoma.
25771201 Existing knowledge regarding the role of CDH2 and CDH11 during development and differentiation in vivo and in vitro is reviewed. [review]
25173800 This study evaluated the expression of CAD11 in the peripheral blood of rheumatoid arthritis patients and normal controls.
24940649 Cadherin 11, a miR-675 target, induces N-cadherin expression and epithelial-mesenchymal transition in melasma.
More...

AA Sequence

MKENYCLQAALVCLGMLCHSHAFAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQFFVIEEYTGPD      1 - 70
PVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPLE     71 - 140
PPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQVTASDADDPTYGNSAKLVYSILEGQPYFSV    141 - 210
EAQTGIIRTALPNMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEA    211 - 280
AVPGEEVGRVKAKDPDIGENGLVTYNIVDGDGMESFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAA    281 - 350
NVHIDPKFISNGPFKDTVTVKISVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYS    351 - 420
IDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIRVLDVNDNAPKFAA    421 - 490
PYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGF    491 - 560
SRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLSTGALIAILACIVIL    561 - 630
LVIVVLFVTLRRQKKEPLIVFEEEDVRENIITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEY    631 - 700
QYMPRPGLRPAPNSVDVDDFINTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYD    701 - 770
YLQNWGPRFKKLADLYGSKDTFDDDS                                                771 - 796
//

Text Mined References (61)

PMID Year Title
26706910 2016 miR-27b is upregulated in cervical carcinogenesis and promotes cell growth and invasion by regulating CDH11 and epithelial-mesenchymal transition.
26519476 2015 Cadherin-11 endocytosis through binding to clathrin promotes cadherin-11-mediated migration in prostate cancer cells.
26476273 2015 Gamma-secretase-independent role for cadherin-11 in neurotrophin receptor p75 (p75(NTR)) mediated glioblastoma cell migration.
26121083 Increased messenger RNA levels of the mesenchymal cadherin-11 in the peripheral blood of systemic sclerosis patients correlate with diffuse skin involvement.
26092671 2015 Cadherin-11 regulates the metastasis of Ewing sarcoma cells to bone.
26046821 2015 Enhanced Adhesion of Stromal Cells to Invasive Cancer Cells Regulated by Cadherin 11.
25919928 2015 Novel DNA methylation markers with potential prognostic relevance in advanced malignant melanoma identified using COBRA assays.
25771201 2015 CDH2 and CDH11 act as regulators of stem cell fate decisions.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25173800 2014 Cadherin-11 mRNA transcripts are frequently found in rheumatoid arthritis peripheral blood and correlate with established polyarthritis.
More...