Property Summary

NCBI Gene PubMed Count 63
PubMed Score 178.45
PubTator Score 111.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.9
Liver cancer 604 0.0 0.6

Expression

  Differential Expression (35)

Disease log2 FC p
active Crohn's disease 2.949 1.3e-03
acute quadriplegic myopathy 1.679 2.2e-04
adult high grade glioma 1.300 1.0e-02
astrocytoma 1.700 4.0e-02
Astrocytoma, Pilocytic 1.500 1.9e-06
atypical teratoid / rhabdoid tumor -1.900 2.1e-04
autosomal dominant Emery-Dreifuss muscul... 1.348 1.4e-02
Breast cancer 3.900 3.0e-02
colon cancer 1.600 4.3e-02
cystic fibrosis -1.179 1.9e-04
Duchenne muscular dystrophy 1.804 3.3e-09
ductal carcinoma in situ 1.500 8.7e-03
ependymoma 1.100 2.9e-02
esophageal adenocarcinoma 2.200 2.4e-02
gastric carcinoma 1.800 2.1e-02
glioblastoma 1.400 5.0e-06
interstitial cystitis -1.200 7.0e-03
interstitial lung disease 1.200 3.1e-02
invasive ductal carcinoma 1.235 3.0e-02
juvenile dermatomyositis 1.421 2.9e-08
limb girdle muscular dystrophy 2B 1.051 1.4e-02
lung adenocarcinoma 1.023 2.5e-03
lung carcinoma -2.300 2.3e-16
malignant mesothelioma -7.100 3.9e-10
medulloblastoma, large-cell -1.600 5.8e-03
nasopharyngeal carcinoma 1.200 6.2e-03
osteosarcoma 2.425 1.1e-03
ovarian cancer -2.100 1.7e-10
pancreatic cancer 1.200 6.2e-03
pituitary cancer -2.300 1.3e-04
primary pancreatic ductal adenocarcinoma 1.843 3.8e-03
primary Sjogren syndrome 1.500 1.6e-03
sarcoidosis 1.400 3.6e-03
ulcerative colitis 3.100 1.3e-06
X-linked cerebral adrenoleukodystrophy 1.500 3.5e-02

 CSPA Cell Line (3)

Gene RIF (47)

AA Sequence

MKENYCLQAALVCLGMLCHSHAFAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQFFVIEEYTGPD      1 - 70
PVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPLE     71 - 140
PPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQVTASDADDPTYGNSAKLVYSILEGQPYFSV    141 - 210
EAQTGIIRTALPNMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEA    211 - 280
AVPGEEVGRVKAKDPDIGENGLVTYNIVDGDGMESFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAA    281 - 350
NVHIDPKFISNGPFKDTVTVKISVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYS    351 - 420
IDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIRVLDVNDNAPKFAA    421 - 490
PYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGF    491 - 560
SRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLSTGALIAILACIVIL    561 - 630
LVIVVLFVTLRRQKKEPLIVFEEEDVRENIITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEY    631 - 700
QYMPRPGLRPAPNSVDVDDFINTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYD    701 - 770
YLQNWGPRFKKLADLYGSKDTFDDDS                                                771 - 796
//

Text Mined References (66)

PMID Year Title