Property Summary

NCBI Gene PubMed Count 23
Grant Count 23
R01 Count 16
Funding $1,549,432.4
PubMed Score 54.78
PubTator Score 42.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
urothelial carcinoma 1.100 0.013
ependymoma -1.100 0.023
oligodendroglioma -1.200 0.008
osteosarcoma 1.363 0.000
interstitial cystitis 1.300 0.000
ovarian cancer 2.600 0.000

Gene RIF (2)

PMID Text
24069422 CDH6 is under the control of the transcription factor RUNX2, which we previously described as a crucial mediator of the Id1 pro-invasive function in thyroid tumor cells.
20634887 The chromatin modifications were determined at five PRC2 targets commonly underexpressed in multiple myeloma (CIITA, CXCL12, GATA2, CDH6 and ICSBP/IRF8). The selected genes were confirmed to be underexpressed in MM compared to normal plasma cells.

AA Sequence

MRTYRYFLLLFWVGQPYPTLSTPLSKRTSGFPAKKRALELSGNSKNELNRSKRSWMWNQFFLLEEYTGSD      1 - 70
YQYVGKLHSDQDRGDGSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINRRTGRPVE     71 - 140
PESEFIIKIHDINDNEPIFTKEVYTATVPEMSDVGTFVVQVTATDADDPTYGNSAKVVYSILQGQPYFSV    141 - 210
ESETGIIKTALLNMDRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPES    211 - 280
SPPGTPIGRIKASDADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEAS    281 - 350
NPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNPVKYS    351 - 420
VDRHTDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAE    421 - 490
FYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHE    491 - 560
MSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLSTGALVAILLCIVILLVTV    561 - 630
VLFAALRRQRKKEPLIISKEDIRDNIVSYNDEGGGEEDTQAFDIGTLRNPEAIEDNKLRRDIVPEALFLP    631 - 700
RRTPTARDNTDVRDFINQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDW    701 - 770
GPRFKKLADMYGGVDSDKDS                                                      771 - 790
//

Text Mined References (25)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24069422 2013 Cadherin 6 is a new RUNX2 target in TGF-? signalling pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20709820 2011 Genome-wide association study identifies BICD1 as a susceptibility gene for emphysema.
20634887 2010 Polycomb target genes are silenced in multiple myeloma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...