Property Summary

NCBI Gene PubMed Count 25
PubMed Score 58.85
PubTator Score 42.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cachexia 50 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.3e-07
ovarian cancer 8520 3.6e-04
interstitial cystitis 2312 4.0e-04
oligodendroglioma 2850 7.7e-03
urothelial carcinoma 318 1.3e-02
ependymoma 4679 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.8
Skin cancer 469 0.0 0.8
Disease Target Count Z-score Confidence
Narcolepsy 72 0.0 0.8
Rheumatoid arthritis 1191 0.0 1.6
Disease Target Count Z-score Confidence
Renal Cell Carcinoma 214 4.202 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.100 2.3e-02
interstitial cystitis 1.300 4.0e-04
oligodendroglioma -1.200 7.7e-03
osteosarcoma 1.363 2.3e-07
ovarian cancer 2.600 3.6e-04
urothelial carcinoma 1.100 1.3e-02

Gene RIF (4)

AA Sequence

MRTYRYFLLLFWVGQPYPTLSTPLSKRTSGFPAKKRALELSGNSKNELNRSKRSWMWNQFFLLEEYTGSD      1 - 70
YQYVGKLHSDQDRGDGSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINRRTGRPVE     71 - 140
PESEFIIKIHDINDNEPIFTKEVYTATVPEMSDVGTFVVQVTATDADDPTYGNSAKVVYSILQGQPYFSV    141 - 210
ESETGIIKTALLNMDRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPES    211 - 280
SPPGTPIGRIKASDADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEAS    281 - 350
NPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNPVKYS    351 - 420
VDRHTDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAE    421 - 490
FYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHE    491 - 560
MSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLSTGALVAILLCIVILLVTV    561 - 630
VLFAALRRQRKKEPLIISKEDIRDNIVSYNDEGGGEEDTQAFDIGTLRNPEAIEDNKLRRDIVPEALFLP    631 - 700
RRTPTARDNTDVRDFINQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDW    701 - 770
GPRFKKLADMYGGVDSDKDS                                                      771 - 790
//

Text Mined References (27)

PMID Year Title