Property Summary

NCBI Gene PubMed Count 36
Grant Count 32
R01 Count 29
Funding $2,439,351.53
PubMed Score 91.20
PubTator Score 70.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
cystic fibrosis 2.624 0.000
medulloblastoma, large-cell -2.100 0.000
group 3 medulloblastoma -1.700 0.006
psoriasis -2.500 0.000

Gene RIF (11)

PMID Text
24429027 P-cadherin expression correlated with tumor progression and could be an independent predictor for bladder cancer survival.
22820501 R-cadherin adherens junction formation facilitates a mesenchymal to epithelial-like transition in MDA-MB-231 cells.
22219182 Findings identify an important role of CHD4 in controlling homologous recombination repair to maintain genome stability and establish the potential therapeutic implications of targeting CHD4 deficiency in tumors.
21665361 a novel putative tumor suppressor gene that can be frequently and tumor-specifically inactivated by its promoter methylation in nasopharyngeal carcinoma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
16786001 the degradation of E-cadherin in response to expression of R-cadherin is due to competition for p120(ctn)
15548679 CDH4 may act as a tumor suppressor gene in human gastrointestinal tumors and can potentially be used as an early diagnostic marker for gastrointestinal tumorigenesis
More...

AA Sequence

MTAGAGVLLLLLSLSGALRAHNEDLTTRETCKAGFSEDDYTALISQNILEGEKLLQVKFSSCVGTKGTQY      1 - 70
ETNSMDFKVGADGTVFATRELQVPSEQVAFTVTAWDSQTAEKWDAVVRLLVAQTSSPHSGHKPQKGKKVV     71 - 140
ALDPSPPPKDTLLPWPQHQNANGLRRRKRDWVIPPINVPENSRGPFPQQLVRIRSDKDNDIPIRYSITGV    141 - 210
GADQPPMEVFSIDSMSGRMYVTRPMDREEHASYHLRAHAVDMNGNKVENPIDLYIYVIDMNDNRPEFINQ    211 - 280
VYNGSVDEGSKPGTYVMTVTANDADDSTTANGMVRYRIVTQTPQSPSQNMFTINSETGDIVTVAAGLDRE    281 - 350
KVQQYTVIVQATDMEGNLNYGLSNTATAIITVTDVNDNPPEFTASTFAGEVPENRVETVVANLTVMDRDQ    351 - 420
PHSPNWNAVYRIISGDPSGHFSVRTDPVTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPLASGIQMSFQS    421 - 490
TAGVTISIMDINEAPYFPSNHKLIRLEEGVPPGTVLTTFSAVDPDRFMQQAVRYSKLSDPASWLHINATN    491 - 560
GQITTAAVLDRESLYTKNNVYEATFLAADNGIPPASGTGTLQIYLIDINDNAPELLPKEAQICEKPNLNA    561 - 630
INITAADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPL    631 - 700
SNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGAIVAILICILILLTMVLLFVMWMKRREKERHTKQLLI    701 - 770
DPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPG    771 - 840
DIGDFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSSGDQDYDYLNDWGPRFKKLADMY    841 - 910
GGGEED                                                                    911 - 916
//

Text Mined References (36)

PMID Year Title
24429027 2014 The prognostic value of P-cadherin in non-muscle-invasive bladder cancer.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23279374 2013 Genetic determinants of plasma ??-glycoprotein I levels: a genome-wide association study in extended pedigrees from Spain.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22820501 2012 Small GTPase Rho regulates R-cadherin through Dia1/profilin-1.
22219182 2012 Chromodomain helicase DNA-binding protein 4 (CHD4) regulates homologous recombination DNA repair, and its deficiency sensitizes cells to poly(ADP-ribose) polymerase (PARP) inhibitor treatment.
21665361 2011 CDH4 as a novel putative tumor suppressor gene epigenetically silenced by promoter hypermethylation in nasopharyngeal carcinoma.
More...