Property Summary

NCBI Gene PubMed Count 40
PubMed Score 277.96
PubTator Score 107.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
malignant mesothelioma 3232 3.0e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 104 4.414 2.2
Specific language impairment 34 3.126 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 3.0e-06

 GO Function (1)

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (14)

AA Sequence

MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQGHISIPQPDC      1 - 70
PAEARTFSFYLSNIGRDNPQGSFDCIQQYVSSHGEVHLDCLGSIQDKITVCATDDSYQKARQSMAQAEEE     71 - 140
TRSRSAIVIKAGGRYLGKKVQFRKPAPGATDAVPSRKRATPINLASAIRKSGASAVSGGSGVSQRPFRDR    141 - 210
VLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGD    211 - 280
QQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQP    281 - 350
AVNGKLGVPNGREALLPTPGPPASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHSGRDCEHGEAAAPA    351 - 420
PTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHATPGAPADTPGL    421 - 490
NGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLHARIERITRRFTQLDAQLRQL    491 - 560
SQGSEEYETTRGQILQEYRKIKKTNTNYSQEKHRCEYLHSKLAHIKRLIAEYDQRQLQAWP             561 - 621
//

Text Mined References (48)

PMID Year Title