Property Summary

NCBI Gene PubMed Count 39
Grant Count 130
R01 Count 70
Funding $28,632,205.38
PubMed Score 261.19
PubTator Score 107.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 0.000

Synonym

Accession P55199
Symbols MEN
ELL1
PPP1R68
C19orf17

Gene

ELL

PANTHER Protein Class (2)

PDB

2DOA  

 GO Function (1)

 MGI Term (1)

Gene RIF (13)

PMID Text
27009366 This work reveals a previously unrecognized function for ELL as an E3 ubiquitin ligase for c-Myc and a potential tumour suppressor.
26188510 The Tax oncogene enhances ELL incorporation into p300 and P-TEFb containing protein complexes to activate transcription.
24344198 eleven-nineteen lysine-rich leukemia protein enhanced E2F1 deacetylation via recruitment of histone deacetylase 1
24127601 ELL is an essential player for RNA Pol II restart during cellular DNA damage response.
22895430 Studies indicate that the super elongation complex (SEC) consisting of ELL, P-TEFb (CDK9) and MLL required for rapid transcriptional induction in the presence or absence of paused RNA polymerase II (Pol II).
22567366 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
22355797 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
22252557 ELL has an early and essential role during rapid high-amplitude gene expression that is required for both Pol II pause site entry and release
20471949 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
20166137 Our findings suggest that ELL and HIF-1alpha are binding partners and can modulate the functions of each other in hypoxia.
More...

AA Sequence

MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQGHISIPQPDC      1 - 70
PAEARTFSFYLSNIGRDNPQGSFDCIQQYVSSHGEVHLDCLGSIQDKITVCATDDSYQKARQSMAQAEEE     71 - 140
TRSRSAIVIKAGGRYLGKKVQFRKPAPGATDAVPSRKRATPINLASAIRKSGASAVSGGSGVSQRPFRDR    141 - 210
VLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGD    211 - 280
QQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQP    281 - 350
AVNGKLGVPNGREALLPTPGPPASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHSGRDCEHGEAAAPA    351 - 420
PTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHATPGAPADTPGL    421 - 490
NGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLHARIERITRRFTQLDAQLRQL    491 - 560
SQGSEEYETTRGQILQEYRKIKKTNTNYSQEKHRCEYLHSKLAHIKRLIAEYDQRQLQAWP             561 - 621
//

Text Mined References (46)

PMID Year Title
27009366 2016 ELL targets c-Myc for proteasomal degradation and suppresses tumour growth.
26188510 2015 The Tax oncogene enhances ELL incorporation into p300 and P-TEFb containing protein complexes to activate transcription.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24344198 2014 ELL inhibits E2F1 transcriptional activity by enhancing E2F1 deacetylation via recruitment of histone deacetylase 1.
24127601 2013 ELL, a novel TFIIH partner, is involved in transcription restart after DNA repair.
23932780 2013 The little elongation complex functions at initiation and elongation phases of snRNA gene transcription.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895430 2012 The super elongation complex (SEC) family in transcriptional control.
More...