Property Summary

NCBI Gene PubMed Count 14
PubMed Score 28.94
PubTator Score 241.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.100 4.1e-04
Atopic dermatitis -1.200 9.3e-03
atypical teratoid / rhabdoid tumor -1.900 5.4e-05
breast carcinoma -1.900 6.8e-06
ductal carcinoma in situ -2.600 5.7e-04
ependymoma 2.100 1.1e-03
fibroadenoma -1.800 7.8e-03
glioblastoma -2.200 3.6e-10
group 3 medulloblastoma -1.800 7.4e-03
head and neck cancer -2.100 1.3e-02
inflammatory breast cancer -1.100 6.4e-04
invasive ductal carcinoma -1.011 3.3e-03
lung adenocarcinoma -3.300 5.8e-17
lung cancer -1.600 8.6e-05
medulloblastoma, large-cell -1.800 4.0e-03
non-small cell lung cancer -2.512 8.9e-18
primitive neuroectodermal tumor -1.700 1.6e-02

Gene RIF (7)

AA Sequence

MAHVPARTSPGPGPQLLLLLLPLFLLLLRDVAGSHRAPAWSALPAAADGLQGDRDLQRHPGDAAATLGPS      1 - 70
AQDMVAVHMHRLYEKYSRQGARPGGGNTVRSFRARLEVVDQKAVYFFNLTSMQDSEMILTATFHFYSEPP     71 - 140
RWPRALEVLCKPRAKNASGRPLPLGPPTRQHLLFRSLSQNTATQGLLRGAMALAPPPRGLWQAKDISPIV    141 - 210
KAARRDGELLLSAQLDSEERDPGVPRPSPYAPYILVYANDLAISEPNSVAVTLQRYDPFPAGDPEPRAAP    211 - 280
NNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMA    281 - 350
ASQVLDFDEKTMQKARRKQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPS    351 - 420
NHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR                421 - 478
//

Text Mined References (15)

PMID Year Title