Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 3
Funding $357,138.12
PubMed Score 26.71
PubTator Score 241.20

Knowledge Summary

Patent

No data available

Synonym

Accession P55107 Q5VSQ8 Q9UCX6 GDF-10
Symbols BIP
BMP3B
BMP-3b

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
26502261 GDF10 is a stroke-induced signal for axonal sprouting and functional recovery.
25728212 Study shows that GDF10 is down-regulated in patients with oral squamous cell carcinoma, and is an independent risk factor for overall survival. Its expression is regulated by TGFBR3 which shares the signaling inhibiting epithelial-mesenchymal transition.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18949431 BMP3b and BMP6 genes were suppressed by DNA methylation and methylation of BMP3b is significantly frequent in Japanese malignant pleural mesotheliomas (MPMs), suggesting its pathogenic role and the ethnic difference in MPMs.
18077449 new hypoxia-inducible and SOX9-regulated genes, Gdf10 and Chm-I. In addition, Mig6 and InhbA were induced by hypoxia, predominantly via HIF-2alpha
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAHVPARTSPGPGPQLLLLLLPLFLLLLRDVAGSHRAPAWSALPAAADGLQGDRDLQRHPGDAAATLGPS      1 - 70
AQDMVAVHMHRLYEKYSRQGARPGGGNTVRSFRARLEVVDQKAVYFFNLTSMQDSEMILTATFHFYSEPP     71 - 140
RWPRALEVLCKPRAKNASGRPLPLGPPTRQHLLFRSLSQNTATQGLLRGAMALAPPPRGLWQAKDISPIV    141 - 210
KAARRDGELLLSAQLDSEERDPGVPRPSPYAPYILVYANDLAISEPNSVAVTLQRYDPFPAGDPEPRAAP    211 - 280
NNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMA    281 - 350
ASQVLDFDEKTMQKARRKQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPS    351 - 420
NHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR                421 - 478
//

Text Mined References (14)

PMID Year Title
26502261 2015 GDF10 is a signal for axonal sprouting and functional recovery after stroke.
25728212 2016 Loss of GDF10/BMP3b as a prognostic marker collaborates with TGFBR3 to enhance chemotherapy resistance and epithelial-mesenchymal transition in oral squamous cell carcinoma.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18949431 2008 The aberrant promoter methylation of BMP3b and BMP6 in malignant pleural mesotheliomas.
18077449 2008 Hypoxia promotes the differentiated human articular chondrocyte phenotype through SOX9-dependent and -independent pathways.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...