Property Summary

NCBI Gene PubMed Count 131
PubMed Score 454.12
PubTator Score 188.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
breast carcinoma -1.800 1.6e-02
chronic rhinosinusitis 1.030 4.4e-02
intraductal papillary-mucinous adenoma (... 1.300 4.6e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.6e-02
lung adenocarcinoma 1.100 6.0e-04
Multiple Sclerosis 1.400 1.2e-03
osteosarcoma 1.822 1.1e-06
psoriasis -1.500 1.1e-04

Gene RIF (91)

AA Sequence

MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQALGPVSGGHINP      1 - 70
AITLALLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTF     71 - 140
QLALCIFASTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVFWVGP    141 - 210
IVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR                   211 - 265
//

Text Mined References (132)

PMID Year Title