Property Summary

NCBI Gene PubMed Count 113
Grant Count 101
R01 Count 61
Funding $10,812,123.95
PubMed Score 413.81
PubTator Score 188.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -2.400 0.001
osteosarcoma 1.822 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.005
intraductal papillary-mucinous neoplasm ... 1.100 0.016
breast carcinoma -1.800 0.016
Multiple Sclerosis 1.400 0.001
lung adenocarcinoma 1.100 0.001
chronic rhinosinusitis 1.030 0.044

Synonym

Accession P55064 Q6FGW8 AQP-5
Symbols PPKB
AQP-5

Gene

PANTHER Protein Class (1)

PDB

3D9S   5C5X   5DYE  

Gene RIF (74)

PMID Text
26823734 Suggest that sputum AQP1 and AQP5 could be used as diagnostic markers in mild-to-moderate adult-onset asthma.
26614400 AQP5 can be both overexpressed and lost in subgroups of prostate cancers
26569106 AQP5 plasma membrane abundance in transfected HEK293 cells is rapidly and reversibly regulated by at least three independent mechanisms involving phosphorylation at Ser156, protein kinase A activity and extracellular tonicity.
26299924 These results indicate that NFAT5 plays important roles in proliferation and migration of human lung adenocarcinoma cells through regulating AQP5 expression, providing a new therapeutic option for lung adenocarcinoma therapy.
26074259 AQP5 defined a subset of patients with Bcl-2-negative and p16-negative tumours with a poor clinical outcome.
25878490 The hyperosmotic induction of AQP5 and VEGF in retinal pigment epithelial cells was in part dependent on activation of NFAT5.
25781725 Histamine downregulates AQP5 production in human nasal epithelial cells by inhibiting cyclic adenosine monophosphate-responsive element binding protein (CREB) phosphorylation at serine 133.
25721378 Study found a significant correlation between AQP1, AQP3, and AQP5 overexpression and lymph node metastasis in patients with surgically resected colon cancer.
25631586 Aquaporin-5 is expressed in adipocytes with implications in adipose differentiation.
25298246 Down-regulated aquaporin 5 inhibits proliferation and migration of human epithelial ovarian cancer 3AO cells.
More...

AA Sequence

MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQALGPVSGGHINP      1 - 70
AITLALLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTF     71 - 140
QLALCIFASTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVFWVGP    141 - 210
IVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR                   211 - 265
//

Text Mined References (114)

PMID Year Title
26823734 2015 Use of aquaporins 1 and 5 levels as a diagnostic marker in mild-to-moderate adult-onset asthma.
26614400 2016 Aquaporin 5 expression is frequent in prostate cancer and shows a dichotomous correlation with tumor phenotype and PSA recurrence.
26569106 2015 Plasma Membrane Abundance of Human Aquaporin 5 Is Dynamically Regulated by Multiple Pathways.
26299924 2015 NFAT5 promotes proliferation and migration of lung adenocarcinoma cells in part through regulating AQP5 expression.
26074259 2015 AQP1, AQP5, Bcl-2 and p16 in pharyngeal squamous cell carcinoma.
25878490 2015 Regulation of the hyperosmotic induction of aquaporin 5 and VEGF in retinal pigment epithelial cells: involvement of NFAT5.
25781725 Histamine downregulates aquaporin 5 in human nasal epithelial cells.
25721378 2015 Expression of aquaporin-1, aquaporin-3, and aquaporin-5 correlates with nodal metastasis in colon cancer.
25631586 2015 Aquaporin-5 is expressed in adipocytes with implications in adipose differentiation.
25416956 2014 A proteome-scale map of the human interactome network.
More...