Property Summary

NCBI Gene PubMed Count 23
PubMed Score 28.32
PubTator Score 12.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 2.6e-03
Disease Target Count Z-score Confidence
Potocki-Luspski syndrome 5 5.618 2.8
Smith-Magenis syndrome 29 4.552 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 2.6e-03

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (7)

AA Sequence

MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASSKGEGFDVMKSGDARVALIGF      1 - 70
PSVGKSTFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIEGAAQGKGRGRQVIAVARTA     71 - 140
DVIIMMLDATKGEVQRSLLEKELESVGIRLNKHKPNIYFKPKKGGGISFNSTVTLTQCSEKLVQLILHEY    141 - 210
KIFNAEVLFREDCSPDEFIDVIVGNRVYMPCLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLL    211 - 280
EMLWEYLALTCIYTKKRGQRPDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLT    281 - 350
HTMEHEDVIQIVKK                                                            351 - 364
//

Text Mined References (25)

PMID Year Title