Property Summary

NCBI Gene PubMed Count 20
Grant Count 8
R01 Count 5
Funding $488,988.25
PubMed Score 25.24
PubTator Score 12.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Varicocele 21 3.038 1.5
diabetes mellitus 1,663

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 0.003

Gene RIF (4)

PMID Text
26572100 miR19153p functions as a silencer of apoptosis, which regulates lung cancer apoptosis via targeting DRG2/PBX2.
21296692 Basal expression level of DRG2 is regulated by the Sp1 transcription factor.
20877624 Observational study of gene-disease association. (HuGE Navigator)
15113831 overexpression of DRG2 in Jurkat cells affects genes regulating cell-cycle arrest and apoptosis, and that these molecular changes may be important in the growth or differentiation of cells

AA Sequence

MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASSKGEGFDVMKSGDARVALIGF      1 - 70
PSVGKSTFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIEGAAQGKGRGRQVIAVARTA     71 - 140
DVIIMMLDATKGEVQRSLLEKELESVGIRLNKHKPNIYFKPKKGGGISFNSTVTLTQCSEKLVQLILHEY    141 - 210
KIFNAEVLFREDCSPDEFIDVIVGNRVYMPCLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLL    211 - 280
EMLWEYLALTCIYTKKRGQRPDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLT    281 - 350
HTMEHEDVIQIVKK                                                            351 - 364
//

Text Mined References (22)

PMID Year Title
26572100 2016 MicroRNA?1915?3p prevents the apoptosis of lung cancer cells by downregulating DRG2 and PBX2.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21296692 2011 Transcription factor Sp1 regulates basal transcription of the human DRG2 gene.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...