Property Summary

NCBI Gene PubMed Count 32
Grant Count 101
R01 Count 74
Funding $11,942,971.61
PubMed Score 65.43
PubTator Score 45.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 0.026
ependymoma -1.200 0.044
psoriasis 1.200 0.001
osteosarcoma 2.095 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.010
lung cancer 1.200 0.008
adult high grade glioma -1.100 0.001
inflammatory breast cancer 1.100 0.000
ovarian cancer 1.800 0.000

Synonym

Accession P54578 B7Z4N8 J3QRZ5 Q53XY5
Symbols TGT

Gene

PDB

5GJQ   2AYN   2AYO  

Gene RIF (19)

PMID Text
27074503 USP14 shows a marked preference for ubiquitin-cyclin B conjugates that carry more than one ubiquitin modification or chain
26817839 Cell surface ubiquitination precedes endocytosis, after which USP14 acts as an ubiquitin-binding protein that targets the ubiquitinated GABA B receptor to lysosomal degradation and promotes its deubiquitination.
26712154 Increased USP14 expression in patients with breast cancer was associated with a poorer prognosis.
26523394 Akt-mediated phosphorylation of USP14 at Ser432, which normally blocks its catalytic site in the inactive conformation, activates its deubiquitinating activity in vitro and in cells.
26397990 our findings suggested that USP14 is involved in the progression of hepatocellular carcinoma(HCC) and may be a useful therapeutic target in HCC
25429837 our findings suggest that USP14 is involved in the progression of epithelial ovarian cancer
24556800 MiR-4782-3p inhibited cell proliferation in NSCLC by targeting USP14, ZEB2 and XIAP.
24319254 b-AP15 is an inhibitor of deubiquitylating enzyme USP14 and UCHL5 induces apoptosis in multiple myeloma and overcomes bortezomib resistance.
23702845 Downregulation of USP14 expression arrested the cell cycle, which may be related to beta-catenin degradation.
23615914 overexpression of HA-USP14 increased the LPS-, TNFalpha-, or Escherichia coli-induced IL-8 release in human lung epithelial cells.
More...

AA Sequence

MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLL      1 - 70
MMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGAL     71 - 140
RASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRV    141 - 210
LQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFIN    211 - 280
QEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFP    281 - 350
LMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDL    351 - 420
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEE    421 - 490
ESEQ                                                                      491 - 494
//

Text Mined References (43)

PMID Year Title
27074503 2016 USP14 deubiquitinates proteasome-bound substrates that are ubiquitinated at multiple sites.
26817839 2016 Post-endocytotic Deubiquitination and Degradation of the Metabotropic ?-Aminobutyric Acid Receptor by the Ubiquitin-specific Protease 14.
26712154 2016 Downregulation of ubiquitin-specific protease 14 (USP14) inhibits breast cancer cell proliferation and metastasis, but promotes apoptosis.
26523394 2015 Phosphorylation and activation of ubiquitin-specific protease-14 by Akt regulates the ubiquitin-proteasome system.
26397990 2015 USP14 activation promotes tumor progression in hepatocellular carcinoma.
25429837 2015 Ubiquitin-specific protease 14 (USP14) regulates cellular proliferation and apoptosis in epithelial ovarian cancer.
24556800 2014 MiR-4782-3p inhibited non-small cell lung cancer growth via USP14.
24319254 2014 A novel small molecule inhibitor of deubiquitylating enzyme USP14 and UCHL5 induces apoptosis in multiple myeloma and overcomes bortezomib resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23958854 2013 Deubiquitination of Dishevelled by Usp14 is required for Wnt signaling.
More...