Property Summary

NCBI Gene PubMed Count 42
PubMed Score 75.42
PubTator Score 45.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 6.1e-04
astrocytic glioma -1.200 2.6e-02
ependymoma -1.200 4.4e-02
inflammatory breast cancer 1.100 1.6e-04
intraductal papillary-mucinous neoplasm ... 1.400 9.7e-03
lung cancer 1.200 7.6e-03
osteosarcoma 2.095 8.1e-07
ovarian cancer -1.300 4.9e-04
psoriasis 1.200 7.0e-04

Protein-protein Interaction (3)

Gene RIF (29)

AA Sequence

MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLL      1 - 70
MMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGAL     71 - 140
RASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRV    141 - 210
LQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFIN    211 - 280
QEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFP    281 - 350
LMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDL    351 - 420
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEE    421 - 490
ESEQ                                                                      491 - 494
//

Text Mined References (54)

PMID Year Title