Property Summary

NCBI Gene PubMed Count 7
PubMed Score 22.10
PubTator Score 7.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
intraductal papillary-mucinous adenoma (IPMA) 2956 3.79425345442791E-7
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.28774976445924E-7
ovarian cancer 8492 6.89419946451367E-7
intraductal papillary-mucinous neoplasm (IPMN) 3289 7.59657622004989E-5
osteosarcoma 7933 4.58718802435722E-4
diabetes mellitus 1663 0.00135762759091638
psoriasis 6685 0.016083892853556
pancreatic cancer 2300 0.0396030311784673
primary pancreatic ductal adenocarcinoma 1271 0.0482573019506057
Disease Target Count Z-score Confidence
Choledocholithiasis 13 3.547 1.8

Expression

Gene RIF (2)

PMID Text
23918603 Low PNLIPRP1 expression is associated with pancreatic cancer.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYTNENPNNFQIL      1 - 70
LLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNCICVDWKKGSQATYTQAANNV     71 - 140
RVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEAGSKTPGLSRITGLDPVEASFESTPEEVRLD    141 - 210
PSDADFVDVIHTDAAPLIPFLGFGTNQQMGHLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACN    211 - 280
HLRSYKYYLESILNPDGFAAYPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEA    281 - 350
SNFARWRYGVSITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLW    351 - 420
NNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC                           421 - 467
//

Text Mined References (9)

PMID Year Title
24489884 2014 Genome-wide association study of proneness to anger.
23918603 2013 Integration of metabolomics and transcriptomics revealed a fatty acid network exerting growth inhibitory effects in human pancreatic cancer.
19824014 2009 Individual and combined action of pancreatic lipase and pancreatic lipase-related proteins 1 and 2 on native versus homogenized milk fat globules.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1379598 1992 Two novel human pancreatic lipase related proteins, hPLRP1 and hPLRP2. Differences in colipase dependence and in lipase activity.