Property Summary

NCBI Gene PubMed Count 7
Grant Count 3
Funding $432,730.07
PubMed Score 22.10
PubTator Score 7.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
23918603 Low PNLIPRP1 expression is associated with pancreatic cancer.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYTNENPNNFQIL      1 - 70
LLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNCICVDWKKGSQATYTQAANNV     71 - 140
RVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEAGSKTPGLSRITGLDPVEASFESTPEEVRLD    141 - 210
PSDADFVDVIHTDAAPLIPFLGFGTNQQMGHLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACN    211 - 280
HLRSYKYYLESILNPDGFAAYPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEA    281 - 350
SNFARWRYGVSITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLW    351 - 420
NNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC                           421 - 467
//

Text Mined References (9)

PMID Year Title
24489884 2014 Genome-wide association study of proneness to anger.
23918603 2013 Integration of metabolomics and transcriptomics revealed a fatty acid network exerting growth inhibitory effects in human pancreatic cancer.
19824014 2009 Individual and combined action of pancreatic lipase and pancreatic lipase-related proteins 1 and 2 on native versus homogenized milk fat globules.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1379598 1992 Two novel human pancreatic lipase related proteins, hPLRP1 and hPLRP2. Differences in colipase dependence and in lipase activity.