Property Summary

NCBI Gene PubMed Count 31
PubMed Score 39.47
PubTator Score 85.89

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
psoriasis 1.600 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
glioblastoma -1.200 0.002
medulloblastoma, large-cell -1.500 0.000
juvenile dermatomyositis 1.333 0.000
acute quadriplegic myopathy 1.117 0.000
adult high grade glioma -1.300 0.011
aldosterone-producing adenoma -1.121 0.043
lung adenocarcinoma 1.103 0.003
ovarian cancer -1.900 0.000


Accession P54198 Q05BU9 Q8IXN2
Symbols TUP1




  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Pig OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (13)

25512559 HIRA controls a specialized, dynamic H4K16ac-decorated chromatin landscape in senescent cells and enforces tumor suppression.
24074863 Mechanistic studies reveal that HIRA accumulates at sites of UVC irradiation upon detection of DNA damage prior to repair and deposits newly synthesized H3.3 histones. This local action of HIRA depends on ubiquitylation events associated with damage recognition.
23602572 HIRA is required for deposition of histone H3.3 at its binding sites.
22401310 NHRD domain of UBN1 as being an essential region for HIRA interaction and chromatin organization by the HUCA complex
21807893 Data show that, like HIRA, UBN1, and ASF1a, CABIN1 is involved in heterochromatinization of the genome of senescent human cells.
21724829 phosphorylation of histone H4 Ser 47 catalyzed by the PAK2 kinase, promotes nucleosome assembly of H3.3-H4 and inhibits nucleosome assembly of H3.1-H4 by increasing the binding affinity of HIRA to H3.3-H4 and reducing association of CAF-1 with H3.1-H4
21347226 HIRA plays a unique, ASF1a-independent role, which is required for the localization of HP1
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19046189 FISH analysis of metaphases revealed a duplication of TUPLE1 probe on one chromosome 22q (Fig. 1).

AA Sequence

LRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK                                     981 - 1017

Text Mined References (40)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25512559 2014 HIRA orchestrates a dynamic chromatin landscape in senescence and is required for suppression of neoplasia.
24074863 2013 Transcription recovery after DNA damage requires chromatin priming by the H3.3 histone chaperone HIRA.
23602572 2013 Placing the HIRA histone chaperone complex in the chromatin landscape.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22401310 2012 Identification of an ubinuclein 1 region required for stability and function of the human HIRA/UBN1/CABIN1/ASF1a histone H3.3 chaperone complex.
21807893 2011 Human CABIN1 is a functional member of the human HIRA/UBN1/ASF1a histone H3.3 chaperone complex.
21724829 2011 Phosphorylation of H4 Ser 47 promotes HIRA-mediated nucleosome assembly.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21347226 2011 HP1-mediated formation of alternative lengthening of telomeres-associated PML bodies requires HIRA but not ASF1a.