Property Summary

NCBI Gene PubMed Count 26
PubMed Score 7.59
PubTator Score 94.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.083 0.001
Multiple myeloma 1.021 0.014
astrocytic glioma 1.700 0.022
oligodendroglioma 1.400 0.040
glioblastoma 1.300 0.002
Duchenne muscular dystrophy 1.043 0.000
juvenile dermatomyositis 1.240 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.015
pancreatic cancer 1.100 0.000
diabetes mellitus -1.100 0.005
pilocytic astrocytoma 1.300 0.000
acute myeloid leukemia 1.200 0.005
ovarian cancer -1.600 0.000
Down syndrome 1.600 0.000
dermatomyositis 1.100 0.010

Synonym

Accession P53801 B2RDP7 D3DSL9 Q9NS09
Symbols PBF
C21orf1
C21orf3

Gene

 GO Function (1)

Gene RIF (11)

PMID Text
25674221 These findings indicate that miR-584 suppresses glioma cell growth by negatively regulating the expression of PTTG1IP, suggesting that miR-584 has a tumor suppressive role in human glioma pathogenesis.
25408419 these results demonstrate an emerging role for PBF in colorectal tumorigenesis through regulating p53 activity, with implications for PBF as a prognostic indicator for invasive tumors.
24506068 protooncogene PBF is a negative regulator of p53 function in thyroid tumorigenesis, in which PBF is generally overexpressed and p53 mutations are rare compared with other tumor types
23678037 Data from mutant recombinant proteins suggest that proto-oncogene PBF is a phosphoprotein and highlight importance of tyrosine residue Y174 in both endocytosis of PBF and its interaction/co-localization with NIS/SLC5A5 (sodium-iodide symporter).
23221562 Authors identified pituitary tumor-transforming gene 1 (PTTG1) binding factor (PBF) as a target of miR-122 and demonstrated that hepatitis B virus replication causes an obvious increase in PBF levels.
22888961 PBF expression may be a promising biomarker for prognostic and therapeutic purposes in papillary thyroid carcinoma patients.
22404099 The present study provides the first epidemiological evidence that functional regulatory variants of PTTG1IP were associated with the risk of ER-positive breast cancer, further supporting its relevance as one proto-oncogene in breast cancer.
21844185 overexpression of PBF causes thyroid cell proliferation, macrofollicular lesions, and hyperplasia, as well as repression of the critical therapeutic route for radioiodide uptake
21129230 PBF's role in endocrine cancer is discussed. [review]
17297475 overexpression of PTTG and PBF in differentiated thyroid cancer has profound implications for activity of the NIS gene, and hence significantly impacts upon the efficacy of radioiodine treatment.
More...

AA Sequence

MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYP      1 - 70
VTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMRER     71 - 140
EERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN                                  141 - 180
//

Text Mined References (26)

PMID Year Title
25674221 2014 MicroRNA-584 functions as a tumor suppressor and targets PTTG1IP in glioma.
25416956 2014 A proteome-scale map of the human interactome network.
25408419 2016 The proto-oncogene PBF binds p53 and is associated with prognostic features in colorectal cancer.
24506068 2014 The PTTG1-binding factor (PBF/PTTG1IP) regulates p53 activity in thyroid cells.
23678037 2013 Manipulation of PBF/PTTG1IP phosphorylation status; a potential new therapeutic strategy for improving radioiodine uptake in thyroid and other tumors.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23221562 2013 Hepatitis B virus mRNA-mediated miR-122 inhibition upregulates PTTG1-binding protein, which promotes hepatocellular carcinoma tumor growth and cell invasion.
22888961 2013 Prognostic significance of pituitary tumour-transforming gene-binding factor (PBF) expression in papillary thyroid carcinoma.
22404099 2012 Functional variable number of tandem repeats variation in the promoter of proto-oncogene PTTG1IP is associated with risk of estrogen receptor-positive breast cancer.
More...