Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.28
PubTator Score 4.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
CATARACT 42 1 0.0 0.0
Disease Target Count Z-score Confidence
Cataract 297 0.0 4.0
Disease Target Count Z-score Confidence
Lens subluxation 12 4.871 2.4

Expression

Gene RIF (3)

AA Sequence

MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFIL      1 - 70
EKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDV     71 - 140
GSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH                 141 - 197
//

Text Mined References (14)

PMID Year Title