Property Summary

NCBI Gene PubMed Count 27
PubMed Score 4.51
PubTator Score 2.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.140 1.3e-04
atypical teratoid / rhabdoid tumor -1.100 3.3e-03
Breast cancer 2.300 3.8e-02
dermatomyositis 1.700 2.0e-04
group 3 medulloblastoma -1.200 2.8e-02
lung cancer 1.600 2.1e-04
Multiple myeloma 1.392 3.0e-04
ovarian cancer -1.500 8.6e-04
psoriasis 1.200 2.4e-04

Gene RIF (3)

AA Sequence

MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREE      1 - 70
ILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGE     71 - 140
IDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQV    141 - 210
NSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFAD    211 - 280
RPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS                       281 - 331
//

Text Mined References (34)

PMID Year Title