Property Summary

NCBI Gene PubMed Count 27
PubMed Score 4.51
PubTator Score 2.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.541 0.000
psoriasis 1.200 0.000
group 4 medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.100 0.003
acute quadriplegic myopathy 1.140 0.000
lung cancer 1.700 0.001
Breast cancer 2.300 0.038
ovarian cancer 2.200 0.001
dermatomyositis 1.700 0.000

Synonym

Accession P53611 Q92697
Symbols GGTB

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
21990357 an interaction between a transmembrane receptor and RGGTA
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREE      1 - 70
ILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGE     71 - 140
IDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQV    141 - 210
NSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFAD    211 - 280
RPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS                       281 - 331
//

Publication (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21990357 2011 Regulation of ?2-adrenergic receptor maturation and anterograde trafficking by an interaction with Rab geranylgeranyltransferase: modulation of Rab geranylgeranylation by the receptor.
21269460 2011 Initial characterization of the human central proteome.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...