Property Summary

Ligand Count 6
NCBI Gene PubMed Count 14
PubMed Score 118.72
PubTator Score 213.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 3.9e-06

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGR      1 - 70
EEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACLAYTLAR     71 - 140
VYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRVLILVVSAEKKLTG    141 - 210
STVGMRASVETSPLLRFRAESVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAI    211 - 280
SWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPL    281 - 350
SAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPDGLPKPAA                        351 - 400
//

Text Mined References (22)

PMID Year Title