Property Summary

NCBI Gene PubMed Count 14
PubMed Score 104.22
PubTator Score 213.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 0.000

Synonym

Accession P53602 Q53Y65
Symbols MPD
MDDase
POROK7
FP17780

Gene

MVD

PDB

3D4J  

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18823933 functional importance of R161 and N17 in the binding and orientation of mevalonate diphosphate
18660489 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGR      1 - 70
EEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACLAYTLAR     71 - 140
VYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRVLILVVSAEKKLTG    141 - 210
STVGMRASVETSPLLRFRAESVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAI    211 - 280
SWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPL    281 - 350
SAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPDGLPKPAA                        351 - 400
//

Text Mined References (22)

PMID Year Title
26202976 2015 Genomic variations of the mevalonate pathway in porokeratosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18823933 2008 Human mevalonate diphosphate decarboxylase: characterization, investigation of the mevalonate diphosphate binding site, and crystal structure.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...