Property Summary

NCBI Gene PubMed Count 29
PubMed Score 8.45
PubTator Score 12.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma 1.093 3.4e-03
glioblastoma 1.900 2.8e-03
intraductal papillary-mucinous neoplasm ... 1.400 4.6e-03
malignant mesothelioma 1.600 2.4e-06
Multiple myeloma 1.098 3.3e-02
non primary Sjogren syndrome sicca 1.100 2.9e-02
osteosarcoma -1.161 4.6e-03
ovarian cancer 1.700 3.4e-05
sonic hedgehog group medulloblastoma 1.100 1.3e-03

 GO Component (2)

Gene RIF (13)

AA Sequence

MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRE      1 - 70
RNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTEN     71 - 140
TTADGDNAGQ                                                                141 - 150
//

Text Mined References (32)

PMID Year Title