Property Summary

NCBI Gene PubMed Count 28
PubMed Score 8.19
PubTator Score 12.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession P53567 B2R946 Q5U052 C/EBP gamma
Symbols GPE1BP
IG/EBP-1

Gene

 GO Component (2)

Gene RIF (11)

PMID Text
25669928 These findings suggest that CEBPG may play an oncogenic role in BCP-ALL and relies on a mechanism different from CEBPA.
24658403 HIV-1 Tat-mediated upregulation of CCL5 involves JAK2/3, AKT2/3, p38delta, NF-kappaB (p65/p50), C/EBP alpha/gamma, and AP-1 proteins
24244375 HIV-1 Tat-mediated induction of CCL5 in astrocytes involves NF-kappaB, AP-1, C/EBPalpha and C/EBPgamma transcription factors and JAK, PI3K/Akt and p38 MAPK signaling pathways
24244375 HIV-1 Tat-mediated upregulation of CCL5 involves JAK2/3, AKT2/3, p38delta, NF-kappaB (p65/p50), C/EBP alpha/gamma, and AP-1 proteins
23775115 High CEBPG expression correlated with poorer clinical prognoses in several human cancers, and C/EBP gamma depletion decreased proliferation and induced senescence in lung tumor cells.
23160200 CEBPG mediates the myeloid differentiation arrest induced by CEBPA deficiency in acute myeloid leukemia.
22437320 C/EBPgamma positively regulates wound repair both in vitro and in vivo, at least in part, by affecting EGFR signaling.
20237496 Observational study of gene-disease association. (HuGE Navigator)
17893230 CEBPG regulates ERCC5 expression and this regulation is modified by E2F1/YY1 interactions.
16255782 CEBPG is the transcription factor primarily responsible for regulating transcription of key antioxidant and DNA repair genes in non-bronchogenic carcinoma individuals
More...

AA Sequence

MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRE      1 - 70
RNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTEN     71 - 140
TTADGDNAGQ                                                                141 - 150
//

Text Mined References (30)

PMID Year Title
25669928 2015 B-cell precursor acute lymphoblastic leukemia with isolated t(14;19)(q32;q13) abnormality involving the CEBPG gene.
25416956 2014 A proteome-scale map of the human interactome network.
24244375 2013 HIV-1 Tat-mediated induction of CCL5 in astrocytes involves NF-?B, AP-1, C/EBP? and C/EBP? transcription factors and JAK, PI3K/Akt and p38 MAPK signaling pathways.
23775115 2013 C/EBP? suppresses senescence and inflammatory gene expression by heterodimerizing with C/EBP?.
23160200 2012 C/EBP? deregulation results in differentiation arrest in acute myeloid leukemia.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22437320 2012 C/EBP? regulates wound repair and EGF receptor signaling.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...