Property Summary

NCBI Gene PubMed Count 28
PubMed Score 8.19
PubTator Score 12.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 2.36137826476682E-6
ovarian cancer 8492 3.3762977197647E-5
sonic hedgehog group medulloblastoma 1482 0.00126999027054777
glioblastoma 5572 0.00282798428956856
adrenocortical carcinoma 1427 0.00336706613901952
osteosarcoma 7933 0.00455989485414654
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00461171367971138
non primary Sjogren syndrome sicca 840 0.0290461938223413
Multiple myeloma 1328 0.0332360591514247

Expression

  Differential Expression (9)

Synonym

Accession P53567 B2R946 Q5U052 C/EBP gamma
Symbols GPE1BP
IG/EBP-1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 GO Component (2)

Gene RIF (11)

PMID Text
25669928 These findings suggest that CEBPG may play an oncogenic role in BCP-ALL and relies on a mechanism different from CEBPA.
24658403 HIV-1 Tat-mediated upregulation of CCL5 involves JAK2/3, AKT2/3, p38delta, NF-kappaB (p65/p50), C/EBP alpha/gamma, and AP-1 proteins
24244375 HIV-1 Tat-mediated induction of CCL5 in astrocytes involves NF-kappaB, AP-1, C/EBPalpha and C/EBPgamma transcription factors and JAK, PI3K/Akt and p38 MAPK signaling pathways
24244375 HIV-1 Tat-mediated upregulation of CCL5 involves JAK2/3, AKT2/3, p38delta, NF-kappaB (p65/p50), C/EBP alpha/gamma, and AP-1 proteins
23775115 High CEBPG expression correlated with poorer clinical prognoses in several human cancers, and C/EBP gamma depletion decreased proliferation and induced senescence in lung tumor cells.
23160200 CEBPG mediates the myeloid differentiation arrest induced by CEBPA deficiency in acute myeloid leukemia.
22437320 C/EBPgamma positively regulates wound repair both in vitro and in vivo, at least in part, by affecting EGFR signaling.
20237496 Observational study of gene-disease association. (HuGE Navigator)
17893230 CEBPG regulates ERCC5 expression and this regulation is modified by E2F1/YY1 interactions.
16255782 CEBPG is the transcription factor primarily responsible for regulating transcription of key antioxidant and DNA repair genes in non-bronchogenic carcinoma individuals
More...

AA Sequence

MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRE      1 - 70
RNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTEN     71 - 140
TTADGDNAGQ                                                                141 - 150
//

Text Mined References (30)

PMID Year Title
25669928 2015 B-cell precursor acute lymphoblastic leukemia with isolated t(14;19)(q32;q13) abnormality involving the CEBPG gene.
25416956 2014 A proteome-scale map of the human interactome network.
24244375 2013 HIV-1 Tat-mediated induction of CCL5 in astrocytes involves NF-?B, AP-1, C/EBP? and C/EBP? transcription factors and JAK, PI3K/Akt and p38 MAPK signaling pathways.
23775115 2013 C/EBP? suppresses senescence and inflammatory gene expression by heterodimerizing with C/EBP?.
23160200 2012 C/EBP? deregulation results in differentiation arrest in acute myeloid leukemia.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22437320 2012 C/EBP? regulates wound repair and EGF receptor signaling.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...