Property Summary

NCBI Gene PubMed Count 23
PubMed Score 46.14
PubTator Score 10.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer -1.700 3.5e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.9e-02
malignant mesothelioma -3.000 1.7e-08
osteosarcoma -2.043 3.5e-06
ovarian cancer -1.400 5.3e-09
pancreatic ductal adenocarcinoma liver m... -1.876 4.7e-04
Pick disease -1.200 7.3e-06
psoriasis -2.000 1.4e-04

Gene RIF (13)

AA Sequence

MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRLARLDALDRLD      1 - 70
AAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREGPSRLPGYA     71 - 140
SHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQ    141 - 210
QHTNPGAFGKSDMYIICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFD    211 - 280
KIDLTVEELPAVYTGLFYKLYHKELPENYKTMKGID                                      281 - 316
//

Text Mined References (25)

PMID Year Title