Property Summary

NCBI Gene PubMed Count 23
PubMed Score 42.81
PubTator Score 10.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 1.6541658030456E-8
osteosarcoma 7933 3.51115183355976E-6
Pick disease 1893 7.34974457759857E-6
ovarian cancer 8492 8.86894306035196E-6
psoriasis 6685 1.38729072001296E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 4.70061006534584E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0187141338051217
colon cancer 1475 0.034772411231004

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.000 0.000
psoriasis -2.000 0.000
osteosarcoma -2.043 0.000
pancreatic ductal adenocarcinoma liver m... -1.876 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.019
colon cancer -1.700 0.035
Pick disease -1.200 0.000
ovarian cancer -1.600 0.000

Synonym

Accession P53370 A8K756 O95097 Q9UQD9 Nudix motif 6
Symbols GFG1
GFG-1
ASFGF2
FGF-AS
FGF2AS

Gene

PDB

3FXT   3H95  

  Ortholog (12)

Gene RIF (13)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19416273 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19054571 Observational study of gene-disease association. (HuGE Navigator)
18401527 Thus, survivin, Smac, and PKC alpha might play important roles in the inhibition of apoptosis by FGF-2 in human small cell lung cancer cells.
17681892 hydroxyapatite nanocrystals exposure up-regulated FGF-2 mRNA by 6 fold and increased 18 kDa protein isoform by 40%
More...

AA Sequence

MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRLARLDALDRLD      1 - 70
AAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREGPSRLPGYA     71 - 140
SHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQ    141 - 210
QHTNPGAFGKSDMYIICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFD    211 - 280
KIDLTVEELPAVYTGLFYKLYHKELPENYKTMKGID                                      281 - 316
//

Text Mined References (25)

PMID Year Title
24797007 2014 Genome-wide association study identifies two novel genomic regions in irritable bowel syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19416273 2009 Association study between keratinocyte-derived growth factor gene polymorphisms and susceptibility to vitiligo vulgaris in a Taiwanese population: potential involvement of stem cell factor.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
More...