Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.76
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession P53367 B4DS69 Q2M2X4 Q3SYL4 Q9Y2X6
Symbols HSU52521

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSP      1 - 70
APPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTR     71 - 140
QIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLEL    141 - 210
HEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLG    211 - 280
PRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQ    281 - 350
TLKQFHIKLKTPGVDAPSWLEEQ                                                   351 - 373
//

Text Mined References (23)

PMID Year Title